U.S. flag

An official website of the United States government

Current GenBank Release Notes

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2024

               NCBI-GenBank Flat File Release 260.0

                    Distribution Release Notes

  250803006 sequences,  3213818003787 bases, for traditional GenBank records
 4209804087 sequences, 27968257148275 bases, for set-based (WGS/TSA/TLS) records
 
  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 260.0
1.2 Cutoff Date
1.3 Important Changes in Release 260.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 260.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       Email:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       https://www.ncbi.nlm.nih.gov/genbank/update/
       Email: update@ncbi.nlm.nih.gov

URLs for GenBank's web-based submission tools:

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

See Section 1.5 for additional details about submitting data to GenBank.

*****************************************************************************

  GenBank Release 260.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 260.0, incorporates data processed by the INSDC databases
as of Saturday December 16 at 11:22PM EST. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 260.0

1.3.1 Organizational changes

  The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 1560 with this release:
  
  - the BCT division is now composed of 1201 files (+132)
  - the CON division is now composed of  240 files (+2)
  - the INV division is now composed of 2561 files (+462) 
  - the MAM division is now composed of  349 files (+76)
  - the PAT division is now composed of  269 files (+6)
  - the PLN division is now composed of 2458 files (+745)
  - the PRI division is now composed of   87 files (+10)
  - the ROD division is now composed of  343 files (+29) 
  - the VRL division is now composed of 1095 files (+32)
  - the VRT division is now composed of  575 files (+66)

1.4 Upcoming Changes

1.4.1 The /country qualifier will transition to /geo_loc_name

  As of GenBank Release 262.0 in June 2024, the name of the "country"
qualifier will be changed to "geo_loc_name", to reflect the fact that
it is used for geographic features (for example: islands, oceans and seas)
in addition to country names. For further information, please see:

https://ncbiinsights.ncbi.nlm.nih.gov/2023/12/14/update-genbank-qualifier/

1.4.2 New allowed values for the /country and /collection_date qualifiers

  The INSDC will begin to mandate inclusion of /country (soon to be renamed
as /geo_loc_name, see Section 1.4.1) and /collection_date for sequence
submissions, in alignment with its goal of increasing the number of
sequences for which the origin of a sample can be precisely located in
time and space. This requirement is expected to take effect by the end of
December 2024, and further details can be found at:

https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/

  Because there are valid circumstances in which the country and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:

    missing
    not applicable
    not collected
    not provided
    restricted access
    missing: control sample
    missing: sample group
    missing: synthetic construct
    missing: lab stock
    missing: third party data
    missing: data agreement established pre-2023
    missing: endangered species
    missing: human-identifiable

  The timing for introducing these new values is still uncertain, but the
earliest possible date for their appearance is June 15 2023.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:

	https://www.ncbi.nlm.nih.gov/genbank/submit/

  To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

  Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).

  BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.

  Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:

	table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/

  table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:

	https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/

  Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.

	Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/

  Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.

  SEQUIN.  As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI.  See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 10392 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct1000.seq - Bacterial sequence entries, part 1000.
5. gbbct1001.seq - Bacterial sequence entries, part 1001.
6. gbbct1002.seq - Bacterial sequence entries, part 1002.
7. gbbct1003.seq - Bacterial sequence entries, part 1003.
8. gbbct1004.seq - Bacterial sequence entries, part 1004.
9. gbbct1005.seq - Bacterial sequence entries, part 1005.
10. gbbct1006.seq - Bacterial sequence entries, part 1006.
11. gbbct1007.seq - Bacterial sequence entries, part 1007.
12. gbbct1008.seq - Bacterial sequence entries, part 1008.
13. gbbct1009.seq - Bacterial sequence entries, part 1009.
14. gbbct101.seq - Bacterial sequence entries, part 101.
15. gbbct1010.seq - Bacterial sequence entries, part 1010.
16. gbbct1011.seq - Bacterial sequence entries, part 1011.
17. gbbct1012.seq - Bacterial sequence entries, part 1012.
18. gbbct1013.seq - Bacterial sequence entries, part 1013.
19. gbbct1014.seq - Bacterial sequence entries, part 1014.
20. gbbct1015.seq - Bacterial sequence entries, part 1015.
21. gbbct1016.seq - Bacterial sequence entries, part 1016.
22. gbbct1017.seq - Bacterial sequence entries, part 1017.
23. gbbct1018.seq - Bacterial sequence entries, part 1018.
24. gbbct1019.seq - Bacterial sequence entries, part 1019.
25. gbbct102.seq - Bacterial sequence entries, part 102.
26. gbbct1020.seq - Bacterial sequence entries, part 1020.
27. gbbct1021.seq - Bacterial sequence entries, part 1021.
28. gbbct1022.seq - Bacterial sequence entries, part 1022.
29. gbbct1023.seq - Bacterial sequence entries, part 1023.
30. gbbct1024.seq - Bacterial sequence entries, part 1024.
31. gbbct1025.seq - Bacterial sequence entries, part 1025.
32. gbbct1026.seq - Bacterial sequence entries, part 1026.
33. gbbct1027.seq - Bacterial sequence entries, part 1027.
34. gbbct1028.seq - Bacterial sequence entries, part 1028.
35. gbbct1029.seq - Bacterial sequence entries, part 1029.
36. gbbct103.seq - Bacterial sequence entries, part 103.
37. gbbct1030.seq - Bacterial sequence entries, part 1030.
38. gbbct1031.seq - Bacterial sequence entries, part 1031.
39. gbbct1032.seq - Bacterial sequence entries, part 1032.
40. gbbct1033.seq - Bacterial sequence entries, part 1033.
41. gbbct1034.seq - Bacterial sequence entries, part 1034.
42. gbbct1035.seq - Bacterial sequence entries, part 1035.
43. gbbct1036.seq - Bacterial sequence entries, part 1036.
44. gbbct1037.seq - Bacterial sequence entries, part 1037.
45. gbbct1038.seq - Bacterial sequence entries, part 1038.
46. gbbct1039.seq - Bacterial sequence entries, part 1039.
47. gbbct104.seq - Bacterial sequence entries, part 104.
48. gbbct1040.seq - Bacterial sequence entries, part 1040.
49. gbbct1041.seq - Bacterial sequence entries, part 1041.
50. gbbct1042.seq - Bacterial sequence entries, part 1042.
51. gbbct1043.seq - Bacterial sequence entries, part 1043.
52. gbbct1044.seq - Bacterial sequence entries, part 1044.
53. gbbct1045.seq - Bacterial sequence entries, part 1045.
54. gbbct1046.seq - Bacterial sequence entries, part 1046.
55. gbbct1047.seq - Bacterial sequence entries, part 1047.
56. gbbct1048.seq - Bacterial sequence entries, part 1048.
57. gbbct1049.seq - Bacterial sequence entries, part 1049.
58. gbbct105.seq - Bacterial sequence entries, part 105.
59. gbbct1050.seq - Bacterial sequence entries, part 1050.
60. gbbct1051.seq - Bacterial sequence entries, part 1051.
61. gbbct1052.seq - Bacterial sequence entries, part 1052.
62. gbbct1053.seq - Bacterial sequence entries, part 1053.
63. gbbct1054.seq - Bacterial sequence entries, part 1054.
64. gbbct1055.seq - Bacterial sequence entries, part 1055.
65. gbbct1056.seq - Bacterial sequence entries, part 1056.
66. gbbct1057.seq - Bacterial sequence entries, part 1057.
67. gbbct1058.seq - Bacterial sequence entries, part 1058.
68. gbbct1059.seq - Bacterial sequence entries, part 1059.
69. gbbct106.seq - Bacterial sequence entries, part 106.
70. gbbct1060.seq - Bacterial sequence entries, part 1060.
71. gbbct1061.seq - Bacterial sequence entries, part 1061.
72. gbbct1062.seq - Bacterial sequence entries, part 1062.
73. gbbct1063.seq - Bacterial sequence entries, part 1063.
74. gbbct1064.seq - Bacterial sequence entries, part 1064.
75. gbbct1065.seq - Bacterial sequence entries, part 1065.
76. gbbct1066.seq - Bacterial sequence entries, part 1066.
77. gbbct1067.seq - Bacterial sequence entries, part 1067.
78. gbbct1068.seq - Bacterial sequence entries, part 1068.
79. gbbct1069.seq - Bacterial sequence entries, part 1069.
80. gbbct107.seq - Bacterial sequence entries, part 107.
81. gbbct1070.seq - Bacterial sequence entries, part 1070.
82. gbbct1071.seq - Bacterial sequence entries, part 1071.
83. gbbct1072.seq - Bacterial sequence entries, part 1072.
84. gbbct1073.seq - Bacterial sequence entries, part 1073.
85. gbbct1074.seq - Bacterial sequence entries, part 1074.
86. gbbct1075.seq - Bacterial sequence entries, part 1075.
87. gbbct1076.seq - Bacterial sequence entries, part 1076.
88. gbbct1077.seq - Bacterial sequence entries, part 1077.
89. gbbct1078.seq - Bacterial sequence entries, part 1078.
90. gbbct1079.seq - Bacterial sequence entries, part 1079.
91. gbbct108.seq - Bacterial sequence entries, part 108.
92. gbbct1080.seq - Bacterial sequence entries, part 1080.
93. gbbct1081.seq - Bacterial sequence entries, part 1081.
94. gbbct1082.seq - Bacterial sequence entries, part 1082.
95. gbbct1083.seq - Bacterial sequence entries, part 1083.
96. gbbct1084.seq - Bacterial sequence entries, part 1084.
97. gbbct1085.seq - Bacterial sequence entries, part 1085.
98. gbbct1086.seq - Bacterial sequence entries, part 1086.
99. gbbct1087.seq - Bacterial sequence entries, part 1087.
100. gbbct1088.seq - Bacterial sequence entries, part 1088.
101. gbbct1089.seq - Bacterial sequence entries, part 1089.
102. gbbct109.seq - Bacterial sequence entries, part 109.
103. gbbct1090.seq - Bacterial sequence entries, part 1090.
104. gbbct1091.seq - Bacterial sequence entries, part 1091.
105. gbbct1092.seq - Bacterial sequence entries, part 1092.
106. gbbct1093.seq - Bacterial sequence entries, part 1093.
107. gbbct1094.seq - Bacterial sequence entries, part 1094.
108. gbbct1095.seq - Bacterial sequence entries, part 1095.
109. gbbct1096.seq - Bacterial sequence entries, part 1096.
110. gbbct1097.seq - Bacterial sequence entries, part 1097.
111. gbbct1098.seq - Bacterial sequence entries, part 1098.
112. gbbct1099.seq - Bacterial sequence entries, part 1099.
113. gbbct11.seq - Bacterial sequence entries, part 11.
114. gbbct110.seq - Bacterial sequence entries, part 110.
115. gbbct1100.seq - Bacterial sequence entries, part 1100.
116. gbbct1101.seq - Bacterial sequence entries, part 1101.
117. gbbct1102.seq - Bacterial sequence entries, part 1102.
118. gbbct1103.seq - Bacterial sequence entries, part 1103.
119. gbbct1104.seq - Bacterial sequence entries, part 1104.
120. gbbct1105.seq - Bacterial sequence entries, part 1105.
121. gbbct1106.seq - Bacterial sequence entries, part 1106.
122. gbbct1107.seq - Bacterial sequence entries, part 1107.
123. gbbct1108.seq - Bacterial sequence entries, part 1108.
124. gbbct1109.seq - Bacterial sequence entries, part 1109.
125. gbbct111.seq - Bacterial sequence entries, part 111.
126. gbbct1110.seq - Bacterial sequence entries, part 1110.
127. gbbct1111.seq - Bacterial sequence entries, part 1111.
128. gbbct1112.seq - Bacterial sequence entries, part 1112.
129. gbbct1113.seq - Bacterial sequence entries, part 1113.
130. gbbct1114.seq - Bacterial sequence entries, part 1114.
131. gbbct1115.seq - Bacterial sequence entries, part 1115.
132. gbbct1116.seq - Bacterial sequence entries, part 1116.
133. gbbct1117.seq - Bacterial sequence entries, part 1117.
134. gbbct1118.seq - Bacterial sequence entries, part 1118.
135. gbbct1119.seq - Bacterial sequence entries, part 1119.
136. gbbct112.seq - Bacterial sequence entries, part 112.
137. gbbct1120.seq - Bacterial sequence entries, part 1120.
138. gbbct1121.seq - Bacterial sequence entries, part 1121.
139. gbbct1122.seq - Bacterial sequence entries, part 1122.
140. gbbct1123.seq - Bacterial sequence entries, part 1123.
141. gbbct1124.seq - Bacterial sequence entries, part 1124.
142. gbbct1125.seq - Bacterial sequence entries, part 1125.
143. gbbct1126.seq - Bacterial sequence entries, part 1126.
144. gbbct1127.seq - Bacterial sequence entries, part 1127.
145. gbbct1128.seq - Bacterial sequence entries, part 1128.
146. gbbct1129.seq - Bacterial sequence entries, part 1129.
147. gbbct113.seq - Bacterial sequence entries, part 113.
148. gbbct1130.seq - Bacterial sequence entries, part 1130.
149. gbbct1131.seq - Bacterial sequence entries, part 1131.
150. gbbct1132.seq - Bacterial sequence entries, part 1132.
151. gbbct1133.seq - Bacterial sequence entries, part 1133.
152. gbbct1134.seq - Bacterial sequence entries, part 1134.
153. gbbct1135.seq - Bacterial sequence entries, part 1135.
154. gbbct1136.seq - Bacterial sequence entries, part 1136.
155. gbbct1137.seq - Bacterial sequence entries, part 1137.
156. gbbct1138.seq - Bacterial sequence entries, part 1138.
157. gbbct1139.seq - Bacterial sequence entries, part 1139.
158. gbbct114.seq - Bacterial sequence entries, part 114.
159. gbbct1140.seq - Bacterial sequence entries, part 1140.
160. gbbct1141.seq - Bacterial sequence entries, part 1141.
161. gbbct1142.seq - Bacterial sequence entries, part 1142.
162. gbbct1143.seq - Bacterial sequence entries, part 1143.
163. gbbct1144.seq - Bacterial sequence entries, part 1144.
164. gbbct1145.seq - Bacterial sequence entries, part 1145.
165. gbbct1146.seq - Bacterial sequence entries, part 1146.
166. gbbct1147.seq - Bacterial sequence entries, part 1147.
167. gbbct1148.seq - Bacterial sequence entries, part 1148.
168. gbbct1149.seq - Bacterial sequence entries, part 1149.
169. gbbct115.seq - Bacterial sequence entries, part 115.
170. gbbct1150.seq - Bacterial sequence entries, part 1150.
171. gbbct1151.seq - Bacterial sequence entries, part 1151.
172. gbbct1152.seq - Bacterial sequence entries, part 1152.
173. gbbct1153.seq - Bacterial sequence entries, part 1153.
174. gbbct1154.seq - Bacterial sequence entries, part 1154.
175. gbbct1155.seq - Bacterial sequence entries, part 1155.
176. gbbct1156.seq - Bacterial sequence entries, part 1156.
177. gbbct1157.seq - Bacterial sequence entries, part 1157.
178. gbbct1158.seq - Bacterial sequence entries, part 1158.
179. gbbct1159.seq - Bacterial sequence entries, part 1159.
180. gbbct116.seq - Bacterial sequence entries, part 116.
181. gbbct1160.seq - Bacterial sequence entries, part 1160.
182. gbbct1161.seq - Bacterial sequence entries, part 1161.
183. gbbct1162.seq - Bacterial sequence entries, part 1162.
184. gbbct1163.seq - Bacterial sequence entries, part 1163.
185. gbbct1164.seq - Bacterial sequence entries, part 1164.
186. gbbct1165.seq - Bacterial sequence entries, part 1165.
187. gbbct1166.seq - Bacterial sequence entries, part 1166.
188. gbbct1167.seq - Bacterial sequence entries, part 1167.
189. gbbct1168.seq - Bacterial sequence entries, part 1168.
190. gbbct1169.seq - Bacterial sequence entries, part 1169.
191. gbbct117.seq - Bacterial sequence entries, part 117.
192. gbbct1170.seq - Bacterial sequence entries, part 1170.
193. gbbct1171.seq - Bacterial sequence entries, part 1171.
194. gbbct1172.seq - Bacterial sequence entries, part 1172.
195. gbbct1173.seq - Bacterial sequence entries, part 1173.
196. gbbct1174.seq - Bacterial sequence entries, part 1174.
197. gbbct1175.seq - Bacterial sequence entries, part 1175.
198. gbbct1176.seq - Bacterial sequence entries, part 1176.
199. gbbct1177.seq - Bacterial sequence entries, part 1177.
200. gbbct1178.seq - Bacterial sequence entries, part 1178.
201. gbbct1179.seq - Bacterial sequence entries, part 1179.
202. gbbct118.seq - Bacterial sequence entries, part 118.
203. gbbct1180.seq - Bacterial sequence entries, part 1180.
204. gbbct1181.seq - Bacterial sequence entries, part 1181.
205. gbbct1182.seq - Bacterial sequence entries, part 1182.
206. gbbct1183.seq - Bacterial sequence entries, part 1183.
207. gbbct1184.seq - Bacterial sequence entries, part 1184.
208. gbbct1185.seq - Bacterial sequence entries, part 1185.
209. gbbct1186.seq - Bacterial sequence entries, part 1186.
210. gbbct1187.seq - Bacterial sequence entries, part 1187.
211. gbbct1188.seq - Bacterial sequence entries, part 1188.
212. gbbct1189.seq - Bacterial sequence entries, part 1189.
213. gbbct119.seq - Bacterial sequence entries, part 119.
214. gbbct1190.seq - Bacterial sequence entries, part 1190.
215. gbbct1191.seq - Bacterial sequence entries, part 1191.
216. gbbct1192.seq - Bacterial sequence entries, part 1192.
217. gbbct1193.seq - Bacterial sequence entries, part 1193.
218. gbbct1194.seq - Bacterial sequence entries, part 1194.
219. gbbct1195.seq - Bacterial sequence entries, part 1195.
220. gbbct1196.seq - Bacterial sequence entries, part 1196.
221. gbbct1197.seq - Bacterial sequence entries, part 1197.
222. gbbct1198.seq - Bacterial sequence entries, part 1198.
223. gbbct1199.seq - Bacterial sequence entries, part 1199.
224. gbbct12.seq - Bacterial sequence entries, part 12.
225. gbbct120.seq - Bacterial sequence entries, part 120.
226. gbbct1200.seq - Bacterial sequence entries, part 1200.
227. gbbct1201.seq - Bacterial sequence entries, part 1201.
228. gbbct121.seq - Bacterial sequence entries, part 121.
229. gbbct122.seq - Bacterial sequence entries, part 122.
230. gbbct123.seq - Bacterial sequence entries, part 123.
231. gbbct124.seq - Bacterial sequence entries, part 124.
232. gbbct125.seq - Bacterial sequence entries, part 125.
233. gbbct126.seq - Bacterial sequence entries, part 126.
234. gbbct127.seq - Bacterial sequence entries, part 127.
235. gbbct128.seq - Bacterial sequence entries, part 128.
236. gbbct129.seq - Bacterial sequence entries, part 129.
237. gbbct13.seq - Bacterial sequence entries, part 13.
238. gbbct130.seq - Bacterial sequence entries, part 130.
239. gbbct131.seq - Bacterial sequence entries, part 131.
240. gbbct132.seq - Bacterial sequence entries, part 132.
241. gbbct133.seq - Bacterial sequence entries, part 133.
242. gbbct134.seq - Bacterial sequence entries, part 134.
243. gbbct135.seq - Bacterial sequence entries, part 135.
244. gbbct136.seq - Bacterial sequence entries, part 136.
245. gbbct137.seq - Bacterial sequence entries, part 137.
246. gbbct138.seq - Bacterial sequence entries, part 138.
247. gbbct139.seq - Bacterial sequence entries, part 139.
248. gbbct14.seq - Bacterial sequence entries, part 14.
249. gbbct140.seq - Bacterial sequence entries, part 140.
250. gbbct141.seq - Bacterial sequence entries, part 141.
251. gbbct142.seq - Bacterial sequence entries, part 142.
252. gbbct143.seq - Bacterial sequence entries, part 143.
253. gbbct144.seq - Bacterial sequence entries, part 144.
254. gbbct145.seq - Bacterial sequence entries, part 145.
255. gbbct146.seq - Bacterial sequence entries, part 146.
256. gbbct147.seq - Bacterial sequence entries, part 147.
257. gbbct148.seq - Bacterial sequence entries, part 148.
258. gbbct149.seq - Bacterial sequence entries, part 149.
259. gbbct15.seq - Bacterial sequence entries, part 15.
260. gbbct150.seq - Bacterial sequence entries, part 150.
261. gbbct151.seq - Bacterial sequence entries, part 151.
262. gbbct152.seq - Bacterial sequence entries, part 152.
263. gbbct153.seq - Bacterial sequence entries, part 153.
264. gbbct154.seq - Bacterial sequence entries, part 154.
265. gbbct155.seq - Bacterial sequence entries, part 155.
266. gbbct156.seq - Bacterial sequence entries, part 156.
267. gbbct157.seq - Bacterial sequence entries, part 157.
268. gbbct158.seq - Bacterial sequence entries, part 158.
269. gbbct159.seq - Bacterial sequence entries, part 159.
270. gbbct16.seq - Bacterial sequence entries, part 16.
271. gbbct160.seq - Bacterial sequence entries, part 160.
272. gbbct161.seq - Bacterial sequence entries, part 161.
273. gbbct162.seq - Bacterial sequence entries, part 162.
274. gbbct163.seq - Bacterial sequence entries, part 163.
275. gbbct164.seq - Bacterial sequence entries, part 164.
276. gbbct165.seq - Bacterial sequence entries, part 165.
277. gbbct166.seq - Bacterial sequence entries, part 166.
278. gbbct167.seq - Bacterial sequence entries, part 167.
279. gbbct168.seq - Bacterial sequence entries, part 168.
280. gbbct169.seq - Bacterial sequence entries, part 169.
281. gbbct17.seq - Bacterial sequence entries, part 17.
282. gbbct170.seq - Bacterial sequence entries, part 170.
283. gbbct171.seq - Bacterial sequence entries, part 171.
284. gbbct172.seq - Bacterial sequence entries, part 172.
285. gbbct173.seq - Bacterial sequence entries, part 173.
286. gbbct174.seq - Bacterial sequence entries, part 174.
287. gbbct175.seq - Bacterial sequence entries, part 175.
288. gbbct176.seq - Bacterial sequence entries, part 176.
289. gbbct177.seq - Bacterial sequence entries, part 177.
290. gbbct178.seq - Bacterial sequence entries, part 178.
291. gbbct179.seq - Bacterial sequence entries, part 179.
292. gbbct18.seq - Bacterial sequence entries, part 18.
293. gbbct180.seq - Bacterial sequence entries, part 180.
294. gbbct181.seq - Bacterial sequence entries, part 181.
295. gbbct182.seq - Bacterial sequence entries, part 182.
296. gbbct183.seq - Bacterial sequence entries, part 183.
297. gbbct184.seq - Bacterial sequence entries, part 184.
298. gbbct185.seq - Bacterial sequence entries, part 185.
299. gbbct186.seq - Bacterial sequence entries, part 186.
300. gbbct187.seq - Bacterial sequence entries, part 187.
301. gbbct188.seq - Bacterial sequence entries, part 188.
302. gbbct189.seq - Bacterial sequence entries, part 189.
303. gbbct19.seq - Bacterial sequence entries, part 19.
304. gbbct190.seq - Bacterial sequence entries, part 190.
305. gbbct191.seq - Bacterial sequence entries, part 191.
306. gbbct192.seq - Bacterial sequence entries, part 192.
307. gbbct193.seq - Bacterial sequence entries, part 193.
308. gbbct194.seq - Bacterial sequence entries, part 194.
309. gbbct195.seq - Bacterial sequence entries, part 195.
310. gbbct196.seq - Bacterial sequence entries, part 196.
311. gbbct197.seq - Bacterial sequence entries, part 197.
312. gbbct198.seq - Bacterial sequence entries, part 198.
313. gbbct199.seq - Bacterial sequence entries, part 199.
314. gbbct2.seq - Bacterial sequence entries, part 2.
315. gbbct20.seq - Bacterial sequence entries, part 20.
316. gbbct200.seq - Bacterial sequence entries, part 200.
317. gbbct201.seq - Bacterial sequence entries, part 201.
318. gbbct202.seq - Bacterial sequence entries, part 202.
319. gbbct203.seq - Bacterial sequence entries, part 203.
320. gbbct204.seq - Bacterial sequence entries, part 204.
321. gbbct205.seq - Bacterial sequence entries, part 205.
322. gbbct206.seq - Bacterial sequence entries, part 206.
323. gbbct207.seq - Bacterial sequence entries, part 207.
324. gbbct208.seq - Bacterial sequence entries, part 208.
325. gbbct209.seq - Bacterial sequence entries, part 209.
326. gbbct21.seq - Bacterial sequence entries, part 21.
327. gbbct210.seq - Bacterial sequence entries, part 210.
328. gbbct211.seq - Bacterial sequence entries, part 211.
329. gbbct212.seq - Bacterial sequence entries, part 212.
330. gbbct213.seq - Bacterial sequence entries, part 213.
331. gbbct214.seq - Bacterial sequence entries, part 214.
332. gbbct215.seq - Bacterial sequence entries, part 215.
333. gbbct216.seq - Bacterial sequence entries, part 216.
334. gbbct217.seq - Bacterial sequence entries, part 217.
335. gbbct218.seq - Bacterial sequence entries, part 218.
336. gbbct219.seq - Bacterial sequence entries, part 219.
337. gbbct22.seq - Bacterial sequence entries, part 22.
338. gbbct220.seq - Bacterial sequence entries, part 220.
339. gbbct221.seq - Bacterial sequence entries, part 221.
340. gbbct222.seq - Bacterial sequence entries, part 222.
341. gbbct223.seq - Bacterial sequence entries, part 223.
342. gbbct224.seq - Bacterial sequence entries, part 224.
343. gbbct225.seq - Bacterial sequence entries, part 225.
344. gbbct226.seq - Bacterial sequence entries, part 226.
345. gbbct227.seq - Bacterial sequence entries, part 227.
346. gbbct228.seq - Bacterial sequence entries, part 228.
347. gbbct229.seq - Bacterial sequence entries, part 229.
348. gbbct23.seq - Bacterial sequence entries, part 23.
349. gbbct230.seq - Bacterial sequence entries, part 230.
350. gbbct231.seq - Bacterial sequence entries, part 231.
351. gbbct232.seq - Bacterial sequence entries, part 232.
352. gbbct233.seq - Bacterial sequence entries, part 233.
353. gbbct234.seq - Bacterial sequence entries, part 234.
354. gbbct235.seq - Bacterial sequence entries, part 235.
355. gbbct236.seq - Bacterial sequence entries, part 236.
356. gbbct237.seq - Bacterial sequence entries, part 237.
357. gbbct238.seq - Bacterial sequence entries, part 238.
358. gbbct239.seq - Bacterial sequence entries, part 239.
359. gbbct24.seq - Bacterial sequence entries, part 24.
360. gbbct240.seq - Bacterial sequence entries, part 240.
361. gbbct241.seq - Bacterial sequence entries, part 241.
362. gbbct242.seq - Bacterial sequence entries, part 242.
363. gbbct243.seq - Bacterial sequence entries, part 243.
364. gbbct244.seq - Bacterial sequence entries, part 244.
365. gbbct245.seq - Bacterial sequence entries, part 245.
366. gbbct246.seq - Bacterial sequence entries, part 246.
367. gbbct247.seq - Bacterial sequence entries, part 247.
368. gbbct248.seq - Bacterial sequence entries, part 248.
369. gbbct249.seq - Bacterial sequence entries, part 249.
370. gbbct25.seq - Bacterial sequence entries, part 25.
371. gbbct250.seq - Bacterial sequence entries, part 250.
372. gbbct251.seq - Bacterial sequence entries, part 251.
373. gbbct252.seq - Bacterial sequence entries, part 252.
374. gbbct253.seq - Bacterial sequence entries, part 253.
375. gbbct254.seq - Bacterial sequence entries, part 254.
376. gbbct255.seq - Bacterial sequence entries, part 255.
377. gbbct256.seq - Bacterial sequence entries, part 256.
378. gbbct257.seq - Bacterial sequence entries, part 257.
379. gbbct258.seq - Bacterial sequence entries, part 258.
380. gbbct259.seq - Bacterial sequence entries, part 259.
381. gbbct26.seq - Bacterial sequence entries, part 26.
382. gbbct260.seq - Bacterial sequence entries, part 260.
383. gbbct261.seq - Bacterial sequence entries, part 261.
384. gbbct262.seq - Bacterial sequence entries, part 262.
385. gbbct263.seq - Bacterial sequence entries, part 263.
386. gbbct264.seq - Bacterial sequence entries, part 264.
387. gbbct265.seq - Bacterial sequence entries, part 265.
388. gbbct266.seq - Bacterial sequence entries, part 266.
389. gbbct267.seq - Bacterial sequence entries, part 267.
390. gbbct268.seq - Bacterial sequence entries, part 268.
391. gbbct269.seq - Bacterial sequence entries, part 269.
392. gbbct27.seq - Bacterial sequence entries, part 27.
393. gbbct270.seq - Bacterial sequence entries, part 270.
394. gbbct271.seq - Bacterial sequence entries, part 271.
395. gbbct272.seq - Bacterial sequence entries, part 272.
396. gbbct273.seq - Bacterial sequence entries, part 273.
397. gbbct274.seq - Bacterial sequence entries, part 274.
398. gbbct275.seq - Bacterial sequence entries, part 275.
399. gbbct276.seq - Bacterial sequence entries, part 276.
400. gbbct277.seq - Bacterial sequence entries, part 277.
401. gbbct278.seq - Bacterial sequence entries, part 278.
402. gbbct279.seq - Bacterial sequence entries, part 279.
403. gbbct28.seq - Bacterial sequence entries, part 28.
404. gbbct280.seq - Bacterial sequence entries, part 280.
405. gbbct281.seq - Bacterial sequence entries, part 281.
406. gbbct282.seq - Bacterial sequence entries, part 282.
407. gbbct283.seq - Bacterial sequence entries, part 283.
408. gbbct284.seq - Bacterial sequence entries, part 284.
409. gbbct285.seq - Bacterial sequence entries, part 285.
410. gbbct286.seq - Bacterial sequence entries, part 286.
411. gbbct287.seq - Bacterial sequence entries, part 287.
412. gbbct288.seq - Bacterial sequence entries, part 288.
413. gbbct289.seq - Bacterial sequence entries, part 289.
414. gbbct29.seq - Bacterial sequence entries, part 29.
415. gbbct290.seq - Bacterial sequence entries, part 290.
416. gbbct291.seq - Bacterial sequence entries, part 291.
417. gbbct292.seq - Bacterial sequence entries, part 292.
418. gbbct293.seq - Bacterial sequence entries, part 293.
419. gbbct294.seq - Bacterial sequence entries, part 294.
420. gbbct295.seq - Bacterial sequence entries, part 295.
421. gbbct296.seq - Bacterial sequence entries, part 296.
422. gbbct297.seq - Bacterial sequence entries, part 297.
423. gbbct298.seq - Bacterial sequence entries, part 298.
424. gbbct299.seq - Bacterial sequence entries, part 299.
425. gbbct3.seq - Bacterial sequence entries, part 3.
426. gbbct30.seq - Bacterial sequence entries, part 30.
427. gbbct300.seq - Bacterial sequence entries, part 300.
428. gbbct301.seq - Bacterial sequence entries, part 301.
429. gbbct302.seq - Bacterial sequence entries, part 302.
430. gbbct303.seq - Bacterial sequence entries, part 303.
431. gbbct304.seq - Bacterial sequence entries, part 304.
432. gbbct305.seq - Bacterial sequence entries, part 305.
433. gbbct306.seq - Bacterial sequence entries, part 306.
434. gbbct307.seq - Bacterial sequence entries, part 307.
435. gbbct308.seq - Bacterial sequence entries, part 308.
436. gbbct309.seq - Bacterial sequence entries, part 309.
437. gbbct31.seq - Bacterial sequence entries, part 31.
438. gbbct310.seq - Bacterial sequence entries, part 310.
439. gbbct311.seq - Bacterial sequence entries, part 311.
440. gbbct312.seq - Bacterial sequence entries, part 312.
441. gbbct313.seq - Bacterial sequence entries, part 313.
442. gbbct314.seq - Bacterial sequence entries, part 314.
443. gbbct315.seq - Bacterial sequence entries, part 315.
444. gbbct316.seq - Bacterial sequence entries, part 316.
445. gbbct317.seq - Bacterial sequence entries, part 317.
446. gbbct318.seq - Bacterial sequence entries, part 318.
447. gbbct319.seq - Bacterial sequence entries, part 319.
448. gbbct32.seq - Bacterial sequence entries, part 32.
449. gbbct320.seq - Bacterial sequence entries, part 320.
450. gbbct321.seq - Bacterial sequence entries, part 321.
451. gbbct322.seq - Bacterial sequence entries, part 322.
452. gbbct323.seq - Bacterial sequence entries, part 323.
453. gbbct324.seq - Bacterial sequence entries, part 324.
454. gbbct325.seq - Bacterial sequence entries, part 325.
455. gbbct326.seq - Bacterial sequence entries, part 326.
456. gbbct327.seq - Bacterial sequence entries, part 327.
457. gbbct328.seq - Bacterial sequence entries, part 328.
458. gbbct329.seq - Bacterial sequence entries, part 329.
459. gbbct33.seq - Bacterial sequence entries, part 33.
460. gbbct330.seq - Bacterial sequence entries, part 330.
461. gbbct331.seq - Bacterial sequence entries, part 331.
462. gbbct332.seq - Bacterial sequence entries, part 332.
463. gbbct333.seq - Bacterial sequence entries, part 333.
464. gbbct334.seq - Bacterial sequence entries, part 334.
465. gbbct335.seq - Bacterial sequence entries, part 335.
466. gbbct336.seq - Bacterial sequence entries, part 336.
467. gbbct337.seq - Bacterial sequence entries, part 337.
468. gbbct338.seq - Bacterial sequence entries, part 338.
469. gbbct339.seq - Bacterial sequence entries, part 339.
470. gbbct34.seq - Bacterial sequence entries, part 34.
471. gbbct340.seq - Bacterial sequence entries, part 340.
472. gbbct341.seq - Bacterial sequence entries, part 341.
473. gbbct342.seq - Bacterial sequence entries, part 342.
474. gbbct343.seq - Bacterial sequence entries, part 343.
475. gbbct344.seq - Bacterial sequence entries, part 344.
476. gbbct345.seq - Bacterial sequence entries, part 345.
477. gbbct346.seq - Bacterial sequence entries, part 346.
478. gbbct347.seq - Bacterial sequence entries, part 347.
479. gbbct348.seq - Bacterial sequence entries, part 348.
480. gbbct349.seq - Bacterial sequence entries, part 349.
481. gbbct35.seq - Bacterial sequence entries, part 35.
482. gbbct350.seq - Bacterial sequence entries, part 350.
483. gbbct351.seq - Bacterial sequence entries, part 351.
484. gbbct352.seq - Bacterial sequence entries, part 352.
485. gbbct353.seq - Bacterial sequence entries, part 353.
486. gbbct354.seq - Bacterial sequence entries, part 354.
487. gbbct355.seq - Bacterial sequence entries, part 355.
488. gbbct356.seq - Bacterial sequence entries, part 356.
489. gbbct357.seq - Bacterial sequence entries, part 357.
490. gbbct358.seq - Bacterial sequence entries, part 358.
491. gbbct359.seq - Bacterial sequence entries, part 359.
492. gbbct36.seq - Bacterial sequence entries, part 36.
493. gbbct360.seq - Bacterial sequence entries, part 360.
494. gbbct361.seq - Bacterial sequence entries, part 361.
495. gbbct362.seq - Bacterial sequence entries, part 362.
496. gbbct363.seq - Bacterial sequence entries, part 363.
497. gbbct364.seq - Bacterial sequence entries, part 364.
498. gbbct365.seq - Bacterial sequence entries, part 365.
499. gbbct366.seq - Bacterial sequence entries, part 366.
500. gbbct367.seq - Bacterial sequence entries, part 367.
501. gbbct368.seq - Bacterial sequence entries, part 368.
502. gbbct369.seq - Bacterial sequence entries, part 369.
503. gbbct37.seq - Bacterial sequence entries, part 37.
504. gbbct370.seq - Bacterial sequence entries, part 370.
505. gbbct371.seq - Bacterial sequence entries, part 371.
506. gbbct372.seq - Bacterial sequence entries, part 372.
507. gbbct373.seq - Bacterial sequence entries, part 373.
508. gbbct374.seq - Bacterial sequence entries, part 374.
509. gbbct375.seq - Bacterial sequence entries, part 375.
510. gbbct376.seq - Bacterial sequence entries, part 376.
511. gbbct377.seq - Bacterial sequence entries, part 377.
512. gbbct378.seq - Bacterial sequence entries, part 378.
513. gbbct379.seq - Bacterial sequence entries, part 379.
514. gbbct38.seq - Bacterial sequence entries, part 38.
515. gbbct380.seq - Bacterial sequence entries, part 380.
516. gbbct381.seq - Bacterial sequence entries, part 381.
517. gbbct382.seq - Bacterial sequence entries, part 382.
518. gbbct383.seq - Bacterial sequence entries, part 383.
519. gbbct384.seq - Bacterial sequence entries, part 384.
520. gbbct385.seq - Bacterial sequence entries, part 385.
521. gbbct386.seq - Bacterial sequence entries, part 386.
522. gbbct387.seq - Bacterial sequence entries, part 387.
523. gbbct388.seq - Bacterial sequence entries, part 388.
524. gbbct389.seq - Bacterial sequence entries, part 389.
525. gbbct39.seq - Bacterial sequence entries, part 39.
526. gbbct390.seq - Bacterial sequence entries, part 390.
527. gbbct391.seq - Bacterial sequence entries, part 391.
528. gbbct392.seq - Bacterial sequence entries, part 392.
529. gbbct393.seq - Bacterial sequence entries, part 393.
530. gbbct394.seq - Bacterial sequence entries, part 394.
531. gbbct395.seq - Bacterial sequence entries, part 395.
532. gbbct396.seq - Bacterial sequence entries, part 396.
533. gbbct397.seq - Bacterial sequence entries, part 397.
534. gbbct398.seq - Bacterial sequence entries, part 398.
535. gbbct399.seq - Bacterial sequence entries, part 399.
536. gbbct4.seq - Bacterial sequence entries, part 4.
537. gbbct40.seq - Bacterial sequence entries, part 40.
538. gbbct400.seq - Bacterial sequence entries, part 400.
539. gbbct401.seq - Bacterial sequence entries, part 401.
540. gbbct402.seq - Bacterial sequence entries, part 402.
541. gbbct403.seq - Bacterial sequence entries, part 403.
542. gbbct404.seq - Bacterial sequence entries, part 404.
543. gbbct405.seq - Bacterial sequence entries, part 405.
544. gbbct406.seq - Bacterial sequence entries, part 406.
545. gbbct407.seq - Bacterial sequence entries, part 407.
546. gbbct408.seq - Bacterial sequence entries, part 408.
547. gbbct409.seq - Bacterial sequence entries, part 409.
548. gbbct41.seq - Bacterial sequence entries, part 41.
549. gbbct410.seq - Bacterial sequence entries, part 410.
550. gbbct411.seq - Bacterial sequence entries, part 411.
551. gbbct412.seq - Bacterial sequence entries, part 412.
552. gbbct413.seq - Bacterial sequence entries, part 413.
553. gbbct414.seq - Bacterial sequence entries, part 414.
554. gbbct415.seq - Bacterial sequence entries, part 415.
555. gbbct416.seq - Bacterial sequence entries, part 416.
556. gbbct417.seq - Bacterial sequence entries, part 417.
557. gbbct418.seq - Bacterial sequence entries, part 418.
558. gbbct419.seq - Bacterial sequence entries, part 419.
559. gbbct42.seq - Bacterial sequence entries, part 42.
560. gbbct420.seq - Bacterial sequence entries, part 420.
561. gbbct421.seq - Bacterial sequence entries, part 421.
562. gbbct422.seq - Bacterial sequence entries, part 422.
563. gbbct423.seq - Bacterial sequence entries, part 423.
564. gbbct424.seq - Bacterial sequence entries, part 424.
565. gbbct425.seq - Bacterial sequence entries, part 425.
566. gbbct426.seq - Bacterial sequence entries, part 426.
567. gbbct427.seq - Bacterial sequence entries, part 427.
568. gbbct428.seq - Bacterial sequence entries, part 428.
569. gbbct429.seq - Bacterial sequence entries, part 429.
570. gbbct43.seq - Bacterial sequence entries, part 43.
571. gbbct430.seq - Bacterial sequence entries, part 430.
572. gbbct431.seq - Bacterial sequence entries, part 431.
573. gbbct432.seq - Bacterial sequence entries, part 432.
574. gbbct433.seq - Bacterial sequence entries, part 433.
575. gbbct434.seq - Bacterial sequence entries, part 434.
576. gbbct435.seq - Bacterial sequence entries, part 435.
577. gbbct436.seq - Bacterial sequence entries, part 436.
578. gbbct437.seq - Bacterial sequence entries, part 437.
579. gbbct438.seq - Bacterial sequence entries, part 438.
580. gbbct439.seq - Bacterial sequence entries, part 439.
581. gbbct44.seq - Bacterial sequence entries, part 44.
582. gbbct440.seq - Bacterial sequence entries, part 440.
583. gbbct441.seq - Bacterial sequence entries, part 441.
584. gbbct442.seq - Bacterial sequence entries, part 442.
585. gbbct443.seq - Bacterial sequence entries, part 443.
586. gbbct444.seq - Bacterial sequence entries, part 444.
587. gbbct445.seq - Bacterial sequence entries, part 445.
588. gbbct446.seq - Bacterial sequence entries, part 446.
589. gbbct447.seq - Bacterial sequence entries, part 447.
590. gbbct448.seq - Bacterial sequence entries, part 448.
591. gbbct449.seq - Bacterial sequence entries, part 449.
592. gbbct45.seq - Bacterial sequence entries, part 45.
593. gbbct450.seq - Bacterial sequence entries, part 450.
594. gbbct451.seq - Bacterial sequence entries, part 451.
595. gbbct452.seq - Bacterial sequence entries, part 452.
596. gbbct453.seq - Bacterial sequence entries, part 453.
597. gbbct454.seq - Bacterial sequence entries, part 454.
598. gbbct455.seq - Bacterial sequence entries, part 455.
599. gbbct456.seq - Bacterial sequence entries, part 456.
600. gbbct457.seq - Bacterial sequence entries, part 457.
601. gbbct458.seq - Bacterial sequence entries, part 458.
602. gbbct459.seq - Bacterial sequence entries, part 459.
603. gbbct46.seq - Bacterial sequence entries, part 46.
604. gbbct460.seq - Bacterial sequence entries, part 460.
605. gbbct461.seq - Bacterial sequence entries, part 461.
606. gbbct462.seq - Bacterial sequence entries, part 462.
607. gbbct463.seq - Bacterial sequence entries, part 463.
608. gbbct464.seq - Bacterial sequence entries, part 464.
609. gbbct465.seq - Bacterial sequence entries, part 465.
610. gbbct466.seq - Bacterial sequence entries, part 466.
611. gbbct467.seq - Bacterial sequence entries, part 467.
612. gbbct468.seq - Bacterial sequence entries, part 468.
613. gbbct469.seq - Bacterial sequence entries, part 469.
614. gbbct47.seq - Bacterial sequence entries, part 47.
615. gbbct470.seq - Bacterial sequence entries, part 470.
616. gbbct471.seq - Bacterial sequence entries, part 471.
617. gbbct472.seq - Bacterial sequence entries, part 472.
618. gbbct473.seq - Bacterial sequence entries, part 473.
619. gbbct474.seq - Bacterial sequence entries, part 474.
620. gbbct475.seq - Bacterial sequence entries, part 475.
621. gbbct476.seq - Bacterial sequence entries, part 476.
622. gbbct477.seq - Bacterial sequence entries, part 477.
623. gbbct478.seq - Bacterial sequence entries, part 478.
624. gbbct479.seq - Bacterial sequence entries, part 479.
625. gbbct48.seq - Bacterial sequence entries, part 48.
626. gbbct480.seq - Bacterial sequence entries, part 480.
627. gbbct481.seq - Bacterial sequence entries, part 481.
628. gbbct482.seq - Bacterial sequence entries, part 482.
629. gbbct483.seq - Bacterial sequence entries, part 483.
630. gbbct484.seq - Bacterial sequence entries, part 484.
631. gbbct485.seq - Bacterial sequence entries, part 485.
632. gbbct486.seq - Bacterial sequence entries, part 486.
633. gbbct487.seq - Bacterial sequence entries, part 487.
634. gbbct488.seq - Bacterial sequence entries, part 488.
635. gbbct489.seq - Bacterial sequence entries, part 489.
636. gbbct49.seq - Bacterial sequence entries, part 49.
637. gbbct490.seq - Bacterial sequence entries, part 490.
638. gbbct491.seq - Bacterial sequence entries, part 491.
639. gbbct492.seq - Bacterial sequence entries, part 492.
640. gbbct493.seq - Bacterial sequence entries, part 493.
641. gbbct494.seq - Bacterial sequence entries, part 494.
642. gbbct495.seq - Bacterial sequence entries, part 495.
643. gbbct496.seq - Bacterial sequence entries, part 496.
644. gbbct497.seq - Bacterial sequence entries, part 497.
645. gbbct498.seq - Bacterial sequence entries, part 498.
646. gbbct499.seq - Bacterial sequence entries, part 499.
647. gbbct5.seq - Bacterial sequence entries, part 5.
648. gbbct50.seq - Bacterial sequence entries, part 50.
649. gbbct500.seq - Bacterial sequence entries, part 500.
650. gbbct501.seq - Bacterial sequence entries, part 501.
651. gbbct502.seq - Bacterial sequence entries, part 502.
652. gbbct503.seq - Bacterial sequence entries, part 503.
653. gbbct504.seq - Bacterial sequence entries, part 504.
654. gbbct505.seq - Bacterial sequence entries, part 505.
655. gbbct506.seq - Bacterial sequence entries, part 506.
656. gbbct507.seq - Bacterial sequence entries, part 507.
657. gbbct508.seq - Bacterial sequence entries, part 508.
658. gbbct509.seq - Bacterial sequence entries, part 509.
659. gbbct51.seq - Bacterial sequence entries, part 51.
660. gbbct510.seq - Bacterial sequence entries, part 510.
661. gbbct511.seq - Bacterial sequence entries, part 511.
662. gbbct512.seq - Bacterial sequence entries, part 512.
663. gbbct513.seq - Bacterial sequence entries, part 513.
664. gbbct514.seq - Bacterial sequence entries, part 514.
665. gbbct515.seq - Bacterial sequence entries, part 515.
666. gbbct516.seq - Bacterial sequence entries, part 516.
667. gbbct517.seq - Bacterial sequence entries, part 517.
668. gbbct518.seq - Bacterial sequence entries, part 518.
669. gbbct519.seq - Bacterial sequence entries, part 519.
670. gbbct52.seq - Bacterial sequence entries, part 52.
671. gbbct520.seq - Bacterial sequence entries, part 520.
672. gbbct521.seq - Bacterial sequence entries, part 521.
673. gbbct522.seq - Bacterial sequence entries, part 522.
674. gbbct523.seq - Bacterial sequence entries, part 523.
675. gbbct524.seq - Bacterial sequence entries, part 524.
676. gbbct525.seq - Bacterial sequence entries, part 525.
677. gbbct526.seq - Bacterial sequence entries, part 526.
678. gbbct527.seq - Bacterial sequence entries, part 527.
679. gbbct528.seq - Bacterial sequence entries, part 528.
680. gbbct529.seq - Bacterial sequence entries, part 529.
681. gbbct53.seq - Bacterial sequence entries, part 53.
682. gbbct530.seq - Bacterial sequence entries, part 530.
683. gbbct531.seq - Bacterial sequence entries, part 531.
684. gbbct532.seq - Bacterial sequence entries, part 532.
685. gbbct533.seq - Bacterial sequence entries, part 533.
686. gbbct534.seq - Bacterial sequence entries, part 534.
687. gbbct535.seq - Bacterial sequence entries, part 535.
688. gbbct536.seq - Bacterial sequence entries, part 536.
689. gbbct537.seq - Bacterial sequence entries, part 537.
690. gbbct538.seq - Bacterial sequence entries, part 538.
691. gbbct539.seq - Bacterial sequence entries, part 539.
692. gbbct54.seq - Bacterial sequence entries, part 54.
693. gbbct540.seq - Bacterial sequence entries, part 540.
694. gbbct541.seq - Bacterial sequence entries, part 541.
695. gbbct542.seq - Bacterial sequence entries, part 542.
696. gbbct543.seq - Bacterial sequence entries, part 543.
697. gbbct544.seq - Bacterial sequence entries, part 544.
698. gbbct545.seq - Bacterial sequence entries, part 545.
699. gbbct546.seq - Bacterial sequence entries, part 546.
700. gbbct547.seq - Bacterial sequence entries, part 547.
701. gbbct548.seq - Bacterial sequence entries, part 548.
702. gbbct549.seq - Bacterial sequence entries, part 549.
703. gbbct55.seq - Bacterial sequence entries, part 55.
704. gbbct550.seq - Bacterial sequence entries, part 550.
705. gbbct551.seq - Bacterial sequence entries, part 551.
706. gbbct552.seq - Bacterial sequence entries, part 552.
707. gbbct553.seq - Bacterial sequence entries, part 553.
708. gbbct554.seq - Bacterial sequence entries, part 554.
709. gbbct555.seq - Bacterial sequence entries, part 555.
710. gbbct556.seq - Bacterial sequence entries, part 556.
711. gbbct557.seq - Bacterial sequence entries, part 557.
712. gbbct558.seq - Bacterial sequence entries, part 558.
713. gbbct559.seq - Bacterial sequence entries, part 559.
714. gbbct56.seq - Bacterial sequence entries, part 56.
715. gbbct560.seq - Bacterial sequence entries, part 560.
716. gbbct561.seq - Bacterial sequence entries, part 561.
717. gbbct562.seq - Bacterial sequence entries, part 562.
718. gbbct563.seq - Bacterial sequence entries, part 563.
719. gbbct564.seq - Bacterial sequence entries, part 564.
720. gbbct565.seq - Bacterial sequence entries, part 565.
721. gbbct566.seq - Bacterial sequence entries, part 566.
722. gbbct567.seq - Bacterial sequence entries, part 567.
723. gbbct568.seq - Bacterial sequence entries, part 568.
724. gbbct569.seq - Bacterial sequence entries, part 569.
725. gbbct57.seq - Bacterial sequence entries, part 57.
726. gbbct570.seq - Bacterial sequence entries, part 570.
727. gbbct571.seq - Bacterial sequence entries, part 571.
728. gbbct572.seq - Bacterial sequence entries, part 572.
729. gbbct573.seq - Bacterial sequence entries, part 573.
730. gbbct574.seq - Bacterial sequence entries, part 574.
731. gbbct575.seq - Bacterial sequence entries, part 575.
732. gbbct576.seq - Bacterial sequence entries, part 576.
733. gbbct577.seq - Bacterial sequence entries, part 577.
734. gbbct578.seq - Bacterial sequence entries, part 578.
735. gbbct579.seq - Bacterial sequence entries, part 579.
736. gbbct58.seq - Bacterial sequence entries, part 58.
737. gbbct580.seq - Bacterial sequence entries, part 580.
738. gbbct581.seq - Bacterial sequence entries, part 581.
739. gbbct582.seq - Bacterial sequence entries, part 582.
740. gbbct583.seq - Bacterial sequence entries, part 583.
741. gbbct584.seq - Bacterial sequence entries, part 584.
742. gbbct585.seq - Bacterial sequence entries, part 585.
743. gbbct586.seq - Bacterial sequence entries, part 586.
744. gbbct587.seq - Bacterial sequence entries, part 587.
745. gbbct588.seq - Bacterial sequence entries, part 588.
746. gbbct589.seq - Bacterial sequence entries, part 589.
747. gbbct59.seq - Bacterial sequence entries, part 59.
748. gbbct590.seq - Bacterial sequence entries, part 590.
749. gbbct591.seq - Bacterial sequence entries, part 591.
750. gbbct592.seq - Bacterial sequence entries, part 592.
751. gbbct593.seq - Bacterial sequence entries, part 593.
752. gbbct594.seq - Bacterial sequence entries, part 594.
753. gbbct595.seq - Bacterial sequence entries, part 595.
754. gbbct596.seq - Bacterial sequence entries, part 596.
755. gbbct597.seq - Bacterial sequence entries, part 597.
756. gbbct598.seq - Bacterial sequence entries, part 598.
757. gbbct599.seq - Bacterial sequence entries, part 599.
758. gbbct6.seq - Bacterial sequence entries, part 6.
759. gbbct60.seq - Bacterial sequence entries, part 60.
760. gbbct600.seq - Bacterial sequence entries, part 600.
761. gbbct601.seq - Bacterial sequence entries, part 601.
762. gbbct602.seq - Bacterial sequence entries, part 602.
763. gbbct603.seq - Bacterial sequence entries, part 603.
764. gbbct604.seq - Bacterial sequence entries, part 604.
765. gbbct605.seq - Bacterial sequence entries, part 605.
766. gbbct606.seq - Bacterial sequence entries, part 606.
767. gbbct607.seq - Bacterial sequence entries, part 607.
768. gbbct608.seq - Bacterial sequence entries, part 608.
769. gbbct609.seq - Bacterial sequence entries, part 609.
770. gbbct61.seq - Bacterial sequence entries, part 61.
771. gbbct610.seq - Bacterial sequence entries, part 610.
772. gbbct611.seq - Bacterial sequence entries, part 611.
773. gbbct612.seq - Bacterial sequence entries, part 612.
774. gbbct613.seq - Bacterial sequence entries, part 613.
775. gbbct614.seq - Bacterial sequence entries, part 614.
776. gbbct615.seq - Bacterial sequence entries, part 615.
777. gbbct616.seq - Bacterial sequence entries, part 616.
778. gbbct617.seq - Bacterial sequence entries, part 617.
779. gbbct618.seq - Bacterial sequence entries, part 618.
780. gbbct619.seq - Bacterial sequence entries, part 619.
781. gbbct62.seq - Bacterial sequence entries, part 62.
782. gbbct620.seq - Bacterial sequence entries, part 620.
783. gbbct621.seq - Bacterial sequence entries, part 621.
784. gbbct622.seq - Bacterial sequence entries, part 622.
785. gbbct623.seq - Bacterial sequence entries, part 623.
786. gbbct624.seq - Bacterial sequence entries, part 624.
787. gbbct625.seq - Bacterial sequence entries, part 625.
788. gbbct626.seq - Bacterial sequence entries, part 626.
789. gbbct627.seq - Bacterial sequence entries, part 627.
790. gbbct628.seq - Bacterial sequence entries, part 628.
791. gbbct629.seq - Bacterial sequence entries, part 629.
792. gbbct63.seq - Bacterial sequence entries, part 63.
793. gbbct630.seq - Bacterial sequence entries, part 630.
794. gbbct631.seq - Bacterial sequence entries, part 631.
795. gbbct632.seq - Bacterial sequence entries, part 632.
796. gbbct633.seq - Bacterial sequence entries, part 633.
797. gbbct634.seq - Bacterial sequence entries, part 634.
798. gbbct635.seq - Bacterial sequence entries, part 635.
799. gbbct636.seq - Bacterial sequence entries, part 636.
800. gbbct637.seq - Bacterial sequence entries, part 637.
801. gbbct638.seq - Bacterial sequence entries, part 638.
802. gbbct639.seq - Bacterial sequence entries, part 639.
803. gbbct64.seq - Bacterial sequence entries, part 64.
804. gbbct640.seq - Bacterial sequence entries, part 640.
805. gbbct641.seq - Bacterial sequence entries, part 641.
806. gbbct642.seq - Bacterial sequence entries, part 642.
807. gbbct643.seq - Bacterial sequence entries, part 643.
808. gbbct644.seq - Bacterial sequence entries, part 644.
809. gbbct645.seq - Bacterial sequence entries, part 645.
810. gbbct646.seq - Bacterial sequence entries, part 646.
811. gbbct647.seq - Bacterial sequence entries, part 647.
812. gbbct648.seq - Bacterial sequence entries, part 648.
813. gbbct649.seq - Bacterial sequence entries, part 649.
814. gbbct65.seq - Bacterial sequence entries, part 65.
815. gbbct650.seq - Bacterial sequence entries, part 650.
816. gbbct651.seq - Bacterial sequence entries, part 651.
817. gbbct652.seq - Bacterial sequence entries, part 652.
818. gbbct653.seq - Bacterial sequence entries, part 653.
819. gbbct654.seq - Bacterial sequence entries, part 654.
820. gbbct655.seq - Bacterial sequence entries, part 655.
821. gbbct656.seq - Bacterial sequence entries, part 656.
822. gbbct657.seq - Bacterial sequence entries, part 657.
823. gbbct658.seq - Bacterial sequence entries, part 658.
824. gbbct659.seq - Bacterial sequence entries, part 659.
825. gbbct66.seq - Bacterial sequence entries, part 66.
826. gbbct660.seq - Bacterial sequence entries, part 660.
827. gbbct661.seq - Bacterial sequence entries, part 661.
828. gbbct662.seq - Bacterial sequence entries, part 662.
829. gbbct663.seq - Bacterial sequence entries, part 663.
830. gbbct664.seq - Bacterial sequence entries, part 664.
831. gbbct665.seq - Bacterial sequence entries, part 665.
832. gbbct666.seq - Bacterial sequence entries, part 666.
833. gbbct667.seq - Bacterial sequence entries, part 667.
834. gbbct668.seq - Bacterial sequence entries, part 668.
835. gbbct669.seq - Bacterial sequence entries, part 669.
836. gbbct67.seq - Bacterial sequence entries, part 67.
837. gbbct670.seq - Bacterial sequence entries, part 670.
838. gbbct671.seq - Bacterial sequence entries, part 671.
839. gbbct672.seq - Bacterial sequence entries, part 672.
840. gbbct673.seq - Bacterial sequence entries, part 673.
841. gbbct674.seq - Bacterial sequence entries, part 674.
842. gbbct675.seq - Bacterial sequence entries, part 675.
843. gbbct676.seq - Bacterial sequence entries, part 676.
844. gbbct677.seq - Bacterial sequence entries, part 677.
845. gbbct678.seq - Bacterial sequence entries, part 678.
846. gbbct679.seq - Bacterial sequence entries, part 679.
847. gbbct68.seq - Bacterial sequence entries, part 68.
848. gbbct680.seq - Bacterial sequence entries, part 680.
849. gbbct681.seq - Bacterial sequence entries, part 681.
850. gbbct682.seq - Bacterial sequence entries, part 682.
851. gbbct683.seq - Bacterial sequence entries, part 683.
852. gbbct684.seq - Bacterial sequence entries, part 684.
853. gbbct685.seq - Bacterial sequence entries, part 685.
854. gbbct686.seq - Bacterial sequence entries, part 686.
855. gbbct687.seq - Bacterial sequence entries, part 687.
856. gbbct688.seq - Bacterial sequence entries, part 688.
857. gbbct689.seq - Bacterial sequence entries, part 689.
858. gbbct69.seq - Bacterial sequence entries, part 69.
859. gbbct690.seq - Bacterial sequence entries, part 690.
860. gbbct691.seq - Bacterial sequence entries, part 691.
861. gbbct692.seq - Bacterial sequence entries, part 692.
862. gbbct693.seq - Bacterial sequence entries, part 693.
863. gbbct694.seq - Bacterial sequence entries, part 694.
864. gbbct695.seq - Bacterial sequence entries, part 695.
865. gbbct696.seq - Bacterial sequence entries, part 696.
866. gbbct697.seq - Bacterial sequence entries, part 697.
867. gbbct698.seq - Bacterial sequence entries, part 698.
868. gbbct699.seq - Bacterial sequence entries, part 699.
869. gbbct7.seq - Bacterial sequence entries, part 7.
870. gbbct70.seq - Bacterial sequence entries, part 70.
871. gbbct700.seq - Bacterial sequence entries, part 700.
872. gbbct701.seq - Bacterial sequence entries, part 701.
873. gbbct702.seq - Bacterial sequence entries, part 702.
874. gbbct703.seq - Bacterial sequence entries, part 703.
875. gbbct704.seq - Bacterial sequence entries, part 704.
876. gbbct705.seq - Bacterial sequence entries, part 705.
877. gbbct706.seq - Bacterial sequence entries, part 706.
878. gbbct707.seq - Bacterial sequence entries, part 707.
879. gbbct708.seq - Bacterial sequence entries, part 708.
880. gbbct709.seq - Bacterial sequence entries, part 709.
881. gbbct71.seq - Bacterial sequence entries, part 71.
882. gbbct710.seq - Bacterial sequence entries, part 710.
883. gbbct711.seq - Bacterial sequence entries, part 711.
884. gbbct712.seq - Bacterial sequence entries, part 712.
885. gbbct713.seq - Bacterial sequence entries, part 713.
886. gbbct714.seq - Bacterial sequence entries, part 714.
887. gbbct715.seq - Bacterial sequence entries, part 715.
888. gbbct716.seq - Bacterial sequence entries, part 716.
889. gbbct717.seq - Bacterial sequence entries, part 717.
890. gbbct718.seq - Bacterial sequence entries, part 718.
891. gbbct719.seq - Bacterial sequence entries, part 719.
892. gbbct72.seq - Bacterial sequence entries, part 72.
893. gbbct720.seq - Bacterial sequence entries, part 720.
894. gbbct721.seq - Bacterial sequence entries, part 721.
895. gbbct722.seq - Bacterial sequence entries, part 722.
896. gbbct723.seq - Bacterial sequence entries, part 723.
897. gbbct724.seq - Bacterial sequence entries, part 724.
898. gbbct725.seq - Bacterial sequence entries, part 725.
899. gbbct726.seq - Bacterial sequence entries, part 726.
900. gbbct727.seq - Bacterial sequence entries, part 727.
901. gbbct728.seq - Bacterial sequence entries, part 728.
902. gbbct729.seq - Bacterial sequence entries, part 729.
903. gbbct73.seq - Bacterial sequence entries, part 73.
904. gbbct730.seq - Bacterial sequence entries, part 730.
905. gbbct731.seq - Bacterial sequence entries, part 731.
906. gbbct732.seq - Bacterial sequence entries, part 732.
907. gbbct733.seq - Bacterial sequence entries, part 733.
908. gbbct734.seq - Bacterial sequence entries, part 734.
909. gbbct735.seq - Bacterial sequence entries, part 735.
910. gbbct736.seq - Bacterial sequence entries, part 736.
911. gbbct737.seq - Bacterial sequence entries, part 737.
912. gbbct738.seq - Bacterial sequence entries, part 738.
913. gbbct739.seq - Bacterial sequence entries, part 739.
914. gbbct74.seq - Bacterial sequence entries, part 74.
915. gbbct740.seq - Bacterial sequence entries, part 740.
916. gbbct741.seq - Bacterial sequence entries, part 741.
917. gbbct742.seq - Bacterial sequence entries, part 742.
918. gbbct743.seq - Bacterial sequence entries, part 743.
919. gbbct744.seq - Bacterial sequence entries, part 744.
920. gbbct745.seq - Bacterial sequence entries, part 745.
921. gbbct746.seq - Bacterial sequence entries, part 746.
922. gbbct747.seq - Bacterial sequence entries, part 747.
923. gbbct748.seq - Bacterial sequence entries, part 748.
924. gbbct749.seq - Bacterial sequence entries, part 749.
925. gbbct75.seq - Bacterial sequence entries, part 75.
926. gbbct750.seq - Bacterial sequence entries, part 750.
927. gbbct751.seq - Bacterial sequence entries, part 751.
928. gbbct752.seq - Bacterial sequence entries, part 752.
929. gbbct753.seq - Bacterial sequence entries, part 753.
930. gbbct754.seq - Bacterial sequence entries, part 754.
931. gbbct755.seq - Bacterial sequence entries, part 755.
932. gbbct756.seq - Bacterial sequence entries, part 756.
933. gbbct757.seq - Bacterial sequence entries, part 757.
934. gbbct758.seq - Bacterial sequence entries, part 758.
935. gbbct759.seq - Bacterial sequence entries, part 759.
936. gbbct76.seq - Bacterial sequence entries, part 76.
937. gbbct760.seq - Bacterial sequence entries, part 760.
938. gbbct761.seq - Bacterial sequence entries, part 761.
939. gbbct762.seq - Bacterial sequence entries, part 762.
940. gbbct763.seq - Bacterial sequence entries, part 763.
941. gbbct764.seq - Bacterial sequence entries, part 764.
942. gbbct765.seq - Bacterial sequence entries, part 765.
943. gbbct766.seq - Bacterial sequence entries, part 766.
944. gbbct767.seq - Bacterial sequence entries, part 767.
945. gbbct768.seq - Bacterial sequence entries, part 768.
946. gbbct769.seq - Bacterial sequence entries, part 769.
947. gbbct77.seq - Bacterial sequence entries, part 77.
948. gbbct770.seq - Bacterial sequence entries, part 770.
949. gbbct771.seq - Bacterial sequence entries, part 771.
950. gbbct772.seq - Bacterial sequence entries, part 772.
951. gbbct773.seq - Bacterial sequence entries, part 773.
952. gbbct774.seq - Bacterial sequence entries, part 774.
953. gbbct775.seq - Bacterial sequence entries, part 775.
954. gbbct776.seq - Bacterial sequence entries, part 776.
955. gbbct777.seq - Bacterial sequence entries, part 777.
956. gbbct778.seq - Bacterial sequence entries, part 778.
957. gbbct779.seq - Bacterial sequence entries, part 779.
958. gbbct78.seq - Bacterial sequence entries, part 78.
959. gbbct780.seq - Bacterial sequence entries, part 780.
960. gbbct781.seq - Bacterial sequence entries, part 781.
961. gbbct782.seq - Bacterial sequence entries, part 782.
962. gbbct783.seq - Bacterial sequence entries, part 783.
963. gbbct784.seq - Bacterial sequence entries, part 784.
964. gbbct785.seq - Bacterial sequence entries, part 785.
965. gbbct786.seq - Bacterial sequence entries, part 786.
966. gbbct787.seq - Bacterial sequence entries, part 787.
967. gbbct788.seq - Bacterial sequence entries, part 788.
968. gbbct789.seq - Bacterial sequence entries, part 789.
969. gbbct79.seq - Bacterial sequence entries, part 79.
970. gbbct790.seq - Bacterial sequence entries, part 790.
971. gbbct791.seq - Bacterial sequence entries, part 791.
972. gbbct792.seq - Bacterial sequence entries, part 792.
973. gbbct793.seq - Bacterial sequence entries, part 793.
974. gbbct794.seq - Bacterial sequence entries, part 794.
975. gbbct795.seq - Bacterial sequence entries, part 795.
976. gbbct796.seq - Bacterial sequence entries, part 796.
977. gbbct797.seq - Bacterial sequence entries, part 797.
978. gbbct798.seq - Bacterial sequence entries, part 798.
979. gbbct799.seq - Bacterial sequence entries, part 799.
980. gbbct8.seq - Bacterial sequence entries, part 8.
981. gbbct80.seq - Bacterial sequence entries, part 80.
982. gbbct800.seq - Bacterial sequence entries, part 800.
983. gbbct801.seq - Bacterial sequence entries, part 801.
984. gbbct802.seq - Bacterial sequence entries, part 802.
985. gbbct803.seq - Bacterial sequence entries, part 803.
986. gbbct804.seq - Bacterial sequence entries, part 804.
987. gbbct805.seq - Bacterial sequence entries, part 805.
988. gbbct806.seq - Bacterial sequence entries, part 806.
989. gbbct807.seq - Bacterial sequence entries, part 807.
990. gbbct808.seq - Bacterial sequence entries, part 808.
991. gbbct809.seq - Bacterial sequence entries, part 809.
992. gbbct81.seq - Bacterial sequence entries, part 81.
993. gbbct810.seq - Bacterial sequence entries, part 810.
994. gbbct811.seq - Bacterial sequence entries, part 811.
995. gbbct812.seq - Bacterial sequence entries, part 812.
996. gbbct813.seq - Bacterial sequence entries, part 813.
997. gbbct814.seq - Bacterial sequence entries, part 814.
998. gbbct815.seq - Bacterial sequence entries, part 815.
999. gbbct816.seq - Bacterial sequence entries, part 816.
1000. gbbct817.seq - Bacterial sequence entries, part 817.
1001. gbbct818.seq - Bacterial sequence entries, part 818.
1002. gbbct819.seq - Bacterial sequence entries, part 819.
1003. gbbct82.seq - Bacterial sequence entries, part 82.
1004. gbbct820.seq - Bacterial sequence entries, part 820.
1005. gbbct821.seq - Bacterial sequence entries, part 821.
1006. gbbct822.seq - Bacterial sequence entries, part 822.
1007. gbbct823.seq - Bacterial sequence entries, part 823.
1008. gbbct824.seq - Bacterial sequence entries, part 824.
1009. gbbct825.seq - Bacterial sequence entries, part 825.
1010. gbbct826.seq - Bacterial sequence entries, part 826.
1011. gbbct827.seq - Bacterial sequence entries, part 827.
1012. gbbct828.seq - Bacterial sequence entries, part 828.
1013. gbbct829.seq - Bacterial sequence entries, part 829.
1014. gbbct83.seq - Bacterial sequence entries, part 83.
1015. gbbct830.seq - Bacterial sequence entries, part 830.
1016. gbbct831.seq - Bacterial sequence entries, part 831.
1017. gbbct832.seq - Bacterial sequence entries, part 832.
1018. gbbct833.seq - Bacterial sequence entries, part 833.
1019. gbbct834.seq - Bacterial sequence entries, part 834.
1020. gbbct835.seq - Bacterial sequence entries, part 835.
1021. gbbct836.seq - Bacterial sequence entries, part 836.
1022. gbbct837.seq - Bacterial sequence entries, part 837.
1023. gbbct838.seq - Bacterial sequence entries, part 838.
1024. gbbct839.seq - Bacterial sequence entries, part 839.
1025. gbbct84.seq - Bacterial sequence entries, part 84.
1026. gbbct840.seq - Bacterial sequence entries, part 840.
1027. gbbct841.seq - Bacterial sequence entries, part 841.
1028. gbbct842.seq - Bacterial sequence entries, part 842.
1029. gbbct843.seq - Bacterial sequence entries, part 843.
1030. gbbct844.seq - Bacterial sequence entries, part 844.
1031. gbbct845.seq - Bacterial sequence entries, part 845.
1032. gbbct846.seq - Bacterial sequence entries, part 846.
1033. gbbct847.seq - Bacterial sequence entries, part 847.
1034. gbbct848.seq - Bacterial sequence entries, part 848.
1035. gbbct849.seq - Bacterial sequence entries, part 849.
1036. gbbct85.seq - Bacterial sequence entries, part 85.
1037. gbbct850.seq - Bacterial sequence entries, part 850.
1038. gbbct851.seq - Bacterial sequence entries, part 851.
1039. gbbct852.seq - Bacterial sequence entries, part 852.
1040. gbbct853.seq - Bacterial sequence entries, part 853.
1041. gbbct854.seq - Bacterial sequence entries, part 854.
1042. gbbct855.seq - Bacterial sequence entries, part 855.
1043. gbbct856.seq - Bacterial sequence entries, part 856.
1044. gbbct857.seq - Bacterial sequence entries, part 857.
1045. gbbct858.seq - Bacterial sequence entries, part 858.
1046. gbbct859.seq - Bacterial sequence entries, part 859.
1047. gbbct86.seq - Bacterial sequence entries, part 86.
1048. gbbct860.seq - Bacterial sequence entries, part 860.
1049. gbbct861.seq - Bacterial sequence entries, part 861.
1050. gbbct862.seq - Bacterial sequence entries, part 862.
1051. gbbct863.seq - Bacterial sequence entries, part 863.
1052. gbbct864.seq - Bacterial sequence entries, part 864.
1053. gbbct865.seq - Bacterial sequence entries, part 865.
1054. gbbct866.seq - Bacterial sequence entries, part 866.
1055. gbbct867.seq - Bacterial sequence entries, part 867.
1056. gbbct868.seq - Bacterial sequence entries, part 868.
1057. gbbct869.seq - Bacterial sequence entries, part 869.
1058. gbbct87.seq - Bacterial sequence entries, part 87.
1059. gbbct870.seq - Bacterial sequence entries, part 870.
1060. gbbct871.seq - Bacterial sequence entries, part 871.
1061. gbbct872.seq - Bacterial sequence entries, part 872.
1062. gbbct873.seq - Bacterial sequence entries, part 873.
1063. gbbct874.seq - Bacterial sequence entries, part 874.
1064. gbbct875.seq - Bacterial sequence entries, part 875.
1065. gbbct876.seq - Bacterial sequence entries, part 876.
1066. gbbct877.seq - Bacterial sequence entries, part 877.
1067. gbbct878.seq - Bacterial sequence entries, part 878.
1068. gbbct879.seq - Bacterial sequence entries, part 879.
1069. gbbct88.seq - Bacterial sequence entries, part 88.
1070. gbbct880.seq - Bacterial sequence entries, part 880.
1071. gbbct881.seq - Bacterial sequence entries, part 881.
1072. gbbct882.seq - Bacterial sequence entries, part 882.
1073. gbbct883.seq - Bacterial sequence entries, part 883.
1074. gbbct884.seq - Bacterial sequence entries, part 884.
1075. gbbct885.seq - Bacterial sequence entries, part 885.
1076. gbbct886.seq - Bacterial sequence entries, part 886.
1077. gbbct887.seq - Bacterial sequence entries, part 887.
1078. gbbct888.seq - Bacterial sequence entries, part 888.
1079. gbbct889.seq - Bacterial sequence entries, part 889.
1080. gbbct89.seq - Bacterial sequence entries, part 89.
1081. gbbct890.seq - Bacterial sequence entries, part 890.
1082. gbbct891.seq - Bacterial sequence entries, part 891.
1083. gbbct892.seq - Bacterial sequence entries, part 892.
1084. gbbct893.seq - Bacterial sequence entries, part 893.
1085. gbbct894.seq - Bacterial sequence entries, part 894.
1086. gbbct895.seq - Bacterial sequence entries, part 895.
1087. gbbct896.seq - Bacterial sequence entries, part 896.
1088. gbbct897.seq - Bacterial sequence entries, part 897.
1089. gbbct898.seq - Bacterial sequence entries, part 898.
1090. gbbct899.seq - Bacterial sequence entries, part 899.
1091. gbbct9.seq - Bacterial sequence entries, part 9.
1092. gbbct90.seq - Bacterial sequence entries, part 90.
1093. gbbct900.seq - Bacterial sequence entries, part 900.
1094. gbbct901.seq - Bacterial sequence entries, part 901.
1095. gbbct902.seq - Bacterial sequence entries, part 902.
1096. gbbct903.seq - Bacterial sequence entries, part 903.
1097. gbbct904.seq - Bacterial sequence entries, part 904.
1098. gbbct905.seq - Bacterial sequence entries, part 905.
1099. gbbct906.seq - Bacterial sequence entries, part 906.
1100. gbbct907.seq - Bacterial sequence entries, part 907.
1101. gbbct908.seq - Bacterial sequence entries, part 908.
1102. gbbct909.seq - Bacterial sequence entries, part 909.
1103. gbbct91.seq - Bacterial sequence entries, part 91.
1104. gbbct910.seq - Bacterial sequence entries, part 910.
1105. gbbct911.seq - Bacterial sequence entries, part 911.
1106. gbbct912.seq - Bacterial sequence entries, part 912.
1107. gbbct913.seq - Bacterial sequence entries, part 913.
1108. gbbct914.seq - Bacterial sequence entries, part 914.
1109. gbbct915.seq - Bacterial sequence entries, part 915.
1110. gbbct916.seq - Bacterial sequence entries, part 916.
1111. gbbct917.seq - Bacterial sequence entries, part 917.
1112. gbbct918.seq - Bacterial sequence entries, part 918.
1113. gbbct919.seq - Bacterial sequence entries, part 919.
1114. gbbct92.seq - Bacterial sequence entries, part 92.
1115. gbbct920.seq - Bacterial sequence entries, part 920.
1116. gbbct921.seq - Bacterial sequence entries, part 921.
1117. gbbct922.seq - Bacterial sequence entries, part 922.
1118. gbbct923.seq - Bacterial sequence entries, part 923.
1119. gbbct924.seq - Bacterial sequence entries, part 924.
1120. gbbct925.seq - Bacterial sequence entries, part 925.
1121. gbbct926.seq - Bacterial sequence entries, part 926.
1122. gbbct927.seq - Bacterial sequence entries, part 927.
1123. gbbct928.seq - Bacterial sequence entries, part 928.
1124. gbbct929.seq - Bacterial sequence entries, part 929.
1125. gbbct93.seq - Bacterial sequence entries, part 93.
1126. gbbct930.seq - Bacterial sequence entries, part 930.
1127. gbbct931.seq - Bacterial sequence entries, part 931.
1128. gbbct932.seq - Bacterial sequence entries, part 932.
1129. gbbct933.seq - Bacterial sequence entries, part 933.
1130. gbbct934.seq - Bacterial sequence entries, part 934.
1131. gbbct935.seq - Bacterial sequence entries, part 935.
1132. gbbct936.seq - Bacterial sequence entries, part 936.
1133. gbbct937.seq - Bacterial sequence entries, part 937.
1134. gbbct938.seq - Bacterial sequence entries, part 938.
1135. gbbct939.seq - Bacterial sequence entries, part 939.
1136. gbbct94.seq - Bacterial sequence entries, part 94.
1137. gbbct940.seq - Bacterial sequence entries, part 940.
1138. gbbct941.seq - Bacterial sequence entries, part 941.
1139. gbbct942.seq - Bacterial sequence entries, part 942.
1140. gbbct943.seq - Bacterial sequence entries, part 943.
1141. gbbct944.seq - Bacterial sequence entries, part 944.
1142. gbbct945.seq - Bacterial sequence entries, part 945.
1143. gbbct946.seq - Bacterial sequence entries, part 946.
1144. gbbct947.seq - Bacterial sequence entries, part 947.
1145. gbbct948.seq - Bacterial sequence entries, part 948.
1146. gbbct949.seq - Bacterial sequence entries, part 949.
1147. gbbct95.seq - Bacterial sequence entries, part 95.
1148. gbbct950.seq - Bacterial sequence entries, part 950.
1149. gbbct951.seq - Bacterial sequence entries, part 951.
1150. gbbct952.seq - Bacterial sequence entries, part 952.
1151. gbbct953.seq - Bacterial sequence entries, part 953.
1152. gbbct954.seq - Bacterial sequence entries, part 954.
1153. gbbct955.seq - Bacterial sequence entries, part 955.
1154. gbbct956.seq - Bacterial sequence entries, part 956.
1155. gbbct957.seq - Bacterial sequence entries, part 957.
1156. gbbct958.seq - Bacterial sequence entries, part 958.
1157. gbbct959.seq - Bacterial sequence entries, part 959.
1158. gbbct96.seq - Bacterial sequence entries, part 96.
1159. gbbct960.seq - Bacterial sequence entries, part 960.
1160. gbbct961.seq - Bacterial sequence entries, part 961.
1161. gbbct962.seq - Bacterial sequence entries, part 962.
1162. gbbct963.seq - Bacterial sequence entries, part 963.
1163. gbbct964.seq - Bacterial sequence entries, part 964.
1164. gbbct965.seq - Bacterial sequence entries, part 965.
1165. gbbct966.seq - Bacterial sequence entries, part 966.
1166. gbbct967.seq - Bacterial sequence entries, part 967.
1167. gbbct968.seq - Bacterial sequence entries, part 968.
1168. gbbct969.seq - Bacterial sequence entries, part 969.
1169. gbbct97.seq - Bacterial sequence entries, part 97.
1170. gbbct970.seq - Bacterial sequence entries, part 970.
1171. gbbct971.seq - Bacterial sequence entries, part 971.
1172. gbbct972.seq - Bacterial sequence entries, part 972.
1173. gbbct973.seq - Bacterial sequence entries, part 973.
1174. gbbct974.seq - Bacterial sequence entries, part 974.
1175. gbbct975.seq - Bacterial sequence entries, part 975.
1176. gbbct976.seq - Bacterial sequence entries, part 976.
1177. gbbct977.seq - Bacterial sequence entries, part 977.
1178. gbbct978.seq - Bacterial sequence entries, part 978.
1179. gbbct979.seq - Bacterial sequence entries, part 979.
1180. gbbct98.seq - Bacterial sequence entries, part 98.
1181. gbbct980.seq - Bacterial sequence entries, part 980.
1182. gbbct981.seq - Bacterial sequence entries, part 981.
1183. gbbct982.seq - Bacterial sequence entries, part 982.
1184. gbbct983.seq - Bacterial sequence entries, part 983.
1185. gbbct984.seq - Bacterial sequence entries, part 984.
1186. gbbct985.seq - Bacterial sequence entries, part 985.
1187. gbbct986.seq - Bacterial sequence entries, part 986.
1188. gbbct987.seq - Bacterial sequence entries, part 987.
1189. gbbct988.seq - Bacterial sequence entries, part 988.
1190. gbbct989.seq - Bacterial sequence entries, part 989.
1191. gbbct99.seq - Bacterial sequence entries, part 99.
1192. gbbct990.seq - Bacterial sequence entries, part 990.
1193. gbbct991.seq - Bacterial sequence entries, part 991.
1194. gbbct992.seq - Bacterial sequence entries, part 992.
1195. gbbct993.seq - Bacterial sequence entries, part 993.
1196. gbbct994.seq - Bacterial sequence entries, part 994.
1197. gbbct995.seq - Bacterial sequence entries, part 995.
1198. gbbct996.seq - Bacterial sequence entries, part 996.
1199. gbbct997.seq - Bacterial sequence entries, part 997.
1200. gbbct998.seq - Bacterial sequence entries, part 998.
1201. gbbct999.seq - Bacterial sequence entries, part 999.
1202. gbchg.txt - Accession numbers of entries updated since the previous release.
1203. gbcon1.seq - Constructed sequence entries, part 1.
1204. gbcon10.seq - Constructed sequence entries, part 10.
1205. gbcon100.seq - Constructed sequence entries, part 100.
1206. gbcon101.seq - Constructed sequence entries, part 101.
1207. gbcon102.seq - Constructed sequence entries, part 102.
1208. gbcon103.seq - Constructed sequence entries, part 103.
1209. gbcon104.seq - Constructed sequence entries, part 104.
1210. gbcon105.seq - Constructed sequence entries, part 105.
1211. gbcon106.seq - Constructed sequence entries, part 106.
1212. gbcon107.seq - Constructed sequence entries, part 107.
1213. gbcon108.seq - Constructed sequence entries, part 108.
1214. gbcon109.seq - Constructed sequence entries, part 109.
1215. gbcon11.seq - Constructed sequence entries, part 11.
1216. gbcon110.seq - Constructed sequence entries, part 110.
1217. gbcon111.seq - Constructed sequence entries, part 111.
1218. gbcon112.seq - Constructed sequence entries, part 112.
1219. gbcon113.seq - Constructed sequence entries, part 113.
1220. gbcon114.seq - Constructed sequence entries, part 114.
1221. gbcon115.seq - Constructed sequence entries, part 115.
1222. gbcon116.seq - Constructed sequence entries, part 116.
1223. gbcon117.seq - Constructed sequence entries, part 117.
1224. gbcon118.seq - Constructed sequence entries, part 118.
1225. gbcon119.seq - Constructed sequence entries, part 119.
1226. gbcon12.seq - Constructed sequence entries, part 12.
1227. gbcon120.seq - Constructed sequence entries, part 120.
1228. gbcon121.seq - Constructed sequence entries, part 121.
1229. gbcon122.seq - Constructed sequence entries, part 122.
1230. gbcon123.seq - Constructed sequence entries, part 123.
1231. gbcon124.seq - Constructed sequence entries, part 124.
1232. gbcon125.seq - Constructed sequence entries, part 125.
1233. gbcon126.seq - Constructed sequence entries, part 126.
1234. gbcon127.seq - Constructed sequence entries, part 127.
1235. gbcon128.seq - Constructed sequence entries, part 128.
1236. gbcon129.seq - Constructed sequence entries, part 129.
1237. gbcon13.seq - Constructed sequence entries, part 13.
1238. gbcon130.seq - Constructed sequence entries, part 130.
1239. gbcon131.seq - Constructed sequence entries, part 131.
1240. gbcon132.seq - Constructed sequence entries, part 132.
1241. gbcon133.seq - Constructed sequence entries, part 133.
1242. gbcon134.seq - Constructed sequence entries, part 134.
1243. gbcon135.seq - Constructed sequence entries, part 135.
1244. gbcon136.seq - Constructed sequence entries, part 136.
1245. gbcon137.seq - Constructed sequence entries, part 137.
1246. gbcon138.seq - Constructed sequence entries, part 138.
1247. gbcon139.seq - Constructed sequence entries, part 139.
1248. gbcon14.seq - Constructed sequence entries, part 14.
1249. gbcon140.seq - Constructed sequence entries, part 140.
1250. gbcon141.seq - Constructed sequence entries, part 141.
1251. gbcon142.seq - Constructed sequence entries, part 142.
1252. gbcon143.seq - Constructed sequence entries, part 143.
1253. gbcon144.seq - Constructed sequence entries, part 144.
1254. gbcon145.seq - Constructed sequence entries, part 145.
1255. gbcon146.seq - Constructed sequence entries, part 146.
1256. gbcon147.seq - Constructed sequence entries, part 147.
1257. gbcon148.seq - Constructed sequence entries, part 148.
1258. gbcon149.seq - Constructed sequence entries, part 149.
1259. gbcon15.seq - Constructed sequence entries, part 15.
1260. gbcon150.seq - Constructed sequence entries, part 150.
1261. gbcon151.seq - Constructed sequence entries, part 151.
1262. gbcon152.seq - Constructed sequence entries, part 152.
1263. gbcon153.seq - Constructed sequence entries, part 153.
1264. gbcon154.seq - Constructed sequence entries, part 154.
1265. gbcon155.seq - Constructed sequence entries, part 155.
1266. gbcon156.seq - Constructed sequence entries, part 156.
1267. gbcon157.seq - Constructed sequence entries, part 157.
1268. gbcon158.seq - Constructed sequence entries, part 158.
1269. gbcon159.seq - Constructed sequence entries, part 159.
1270. gbcon16.seq - Constructed sequence entries, part 16.
1271. gbcon160.seq - Constructed sequence entries, part 160.
1272. gbcon161.seq - Constructed sequence entries, part 161.
1273. gbcon162.seq - Constructed sequence entries, part 162.
1274. gbcon163.seq - Constructed sequence entries, part 163.
1275. gbcon164.seq - Constructed sequence entries, part 164.
1276. gbcon165.seq - Constructed sequence entries, part 165.
1277. gbcon166.seq - Constructed sequence entries, part 166.
1278. gbcon167.seq - Constructed sequence entries, part 167.
1279. gbcon168.seq - Constructed sequence entries, part 168.
1280. gbcon169.seq - Constructed sequence entries, part 169.
1281. gbcon17.seq - Constructed sequence entries, part 17.
1282. gbcon170.seq - Constructed sequence entries, part 170.
1283. gbcon171.seq - Constructed sequence entries, part 171.
1284. gbcon172.seq - Constructed sequence entries, part 172.
1285. gbcon173.seq - Constructed sequence entries, part 173.
1286. gbcon174.seq - Constructed sequence entries, part 174.
1287. gbcon175.seq - Constructed sequence entries, part 175.
1288. gbcon176.seq - Constructed sequence entries, part 176.
1289. gbcon177.seq - Constructed sequence entries, part 177.
1290. gbcon178.seq - Constructed sequence entries, part 178.
1291. gbcon179.seq - Constructed sequence entries, part 179.
1292. gbcon18.seq - Constructed sequence entries, part 18.
1293. gbcon180.seq - Constructed sequence entries, part 180.
1294. gbcon181.seq - Constructed sequence entries, part 181.
1295. gbcon182.seq - Constructed sequence entries, part 182.
1296. gbcon183.seq - Constructed sequence entries, part 183.
1297. gbcon184.seq - Constructed sequence entries, part 184.
1298. gbcon185.seq - Constructed sequence entries, part 185.
1299. gbcon186.seq - Constructed sequence entries, part 186.
1300. gbcon187.seq - Constructed sequence entries, part 187.
1301. gbcon188.seq - Constructed sequence entries, part 188.
1302. gbcon189.seq - Constructed sequence entries, part 189.
1303. gbcon19.seq - Constructed sequence entries, part 19.
1304. gbcon190.seq - Constructed sequence entries, part 190.
1305. gbcon191.seq - Constructed sequence entries, part 191.
1306. gbcon192.seq - Constructed sequence entries, part 192.
1307. gbcon193.seq - Constructed sequence entries, part 193.
1308. gbcon194.seq - Constructed sequence entries, part 194.
1309. gbcon195.seq - Constructed sequence entries, part 195.
1310. gbcon196.seq - Constructed sequence entries, part 196.
1311. gbcon197.seq - Constructed sequence entries, part 197.
1312. gbcon198.seq - Constructed sequence entries, part 198.
1313. gbcon199.seq - Constructed sequence entries, part 199.
1314. gbcon2.seq - Constructed sequence entries, part 2.
1315. gbcon20.seq - Constructed sequence entries, part 20.
1316. gbcon200.seq - Constructed sequence entries, part 200.
1317. gbcon201.seq - Constructed sequence entries, part 201.
1318. gbcon202.seq - Constructed sequence entries, part 202.
1319. gbcon203.seq - Constructed sequence entries, part 203.
1320. gbcon204.seq - Constructed sequence entries, part 204.
1321. gbcon205.seq - Constructed sequence entries, part 205.
1322. gbcon206.seq - Constructed sequence entries, part 206.
1323. gbcon207.seq - Constructed sequence entries, part 207.
1324. gbcon208.seq - Constructed sequence entries, part 208.
1325. gbcon209.seq - Constructed sequence entries, part 209.
1326. gbcon21.seq - Constructed sequence entries, part 21.
1327. gbcon210.seq - Constructed sequence entries, part 210.
1328. gbcon211.seq - Constructed sequence entries, part 211.
1329. gbcon212.seq - Constructed sequence entries, part 212.
1330. gbcon213.seq - Constructed sequence entries, part 213.
1331. gbcon214.seq - Constructed sequence entries, part 214.
1332. gbcon215.seq - Constructed sequence entries, part 215.
1333. gbcon216.seq - Constructed sequence entries, part 216.
1334. gbcon217.seq - Constructed sequence entries, part 217.
1335. gbcon218.seq - Constructed sequence entries, part 218.
1336. gbcon219.seq - Constructed sequence entries, part 219.
1337. gbcon22.seq - Constructed sequence entries, part 22.
1338. gbcon220.seq - Constructed sequence entries, part 220.
1339. gbcon221.seq - Constructed sequence entries, part 221.
1340. gbcon222.seq - Constructed sequence entries, part 222.
1341. gbcon223.seq - Constructed sequence entries, part 223.
1342. gbcon224.seq - Constructed sequence entries, part 224.
1343. gbcon225.seq - Constructed sequence entries, part 225.
1344. gbcon226.seq - Constructed sequence entries, part 226.
1345. gbcon227.seq - Constructed sequence entries, part 227.
1346. gbcon228.seq - Constructed sequence entries, part 228.
1347. gbcon229.seq - Constructed sequence entries, part 229.
1348. gbcon23.seq - Constructed sequence entries, part 23.
1349. gbcon230.seq - Constructed sequence entries, part 230.
1350. gbcon231.seq - Constructed sequence entries, part 231.
1351. gbcon232.seq - Constructed sequence entries, part 232.
1352. gbcon233.seq - Constructed sequence entries, part 233.
1353. gbcon234.seq - Constructed sequence entries, part 234.
1354. gbcon235.seq - Constructed sequence entries, part 235.
1355. gbcon236.seq - Constructed sequence entries, part 236.
1356. gbcon237.seq - Constructed sequence entries, part 237.
1357. gbcon238.seq - Constructed sequence entries, part 238.
1358. gbcon239.seq - Constructed sequence entries, part 239.
1359. gbcon24.seq - Constructed sequence entries, part 24.
1360. gbcon240.seq - Constructed sequence entries, part 240.
1361. gbcon25.seq - Constructed sequence entries, part 25.
1362. gbcon26.seq - Constructed sequence entries, part 26.
1363. gbcon27.seq - Constructed sequence entries, part 27.
1364. gbcon28.seq - Constructed sequence entries, part 28.
1365. gbcon29.seq - Constructed sequence entries, part 29.
1366. gbcon3.seq - Constructed sequence entries, part 3.
1367. gbcon30.seq - Constructed sequence entries, part 30.
1368. gbcon31.seq - Constructed sequence entries, part 31.
1369. gbcon32.seq - Constructed sequence entries, part 32.
1370. gbcon33.seq - Constructed sequence entries, part 33.
1371. gbcon34.seq - Constructed sequence entries, part 34.
1372. gbcon35.seq - Constructed sequence entries, part 35.
1373. gbcon36.seq - Constructed sequence entries, part 36.
1374. gbcon37.seq - Constructed sequence entries, part 37.
1375. gbcon38.seq - Constructed sequence entries, part 38.
1376. gbcon39.seq - Constructed sequence entries, part 39.
1377. gbcon4.seq - Constructed sequence entries, part 4.
1378. gbcon40.seq - Constructed sequence entries, part 40.
1379. gbcon41.seq - Constructed sequence entries, part 41.
1380. gbcon42.seq - Constructed sequence entries, part 42.
1381. gbcon43.seq - Constructed sequence entries, part 43.
1382. gbcon44.seq - Constructed sequence entries, part 44.
1383. gbcon45.seq - Constructed sequence entries, part 45.
1384. gbcon46.seq - Constructed sequence entries, part 46.
1385. gbcon47.seq - Constructed sequence entries, part 47.
1386. gbcon48.seq - Constructed sequence entries, part 48.
1387. gbcon49.seq - Constructed sequence entries, part 49.
1388. gbcon5.seq - Constructed sequence entries, part 5.
1389. gbcon50.seq - Constructed sequence entries, part 50.
1390. gbcon51.seq - Constructed sequence entries, part 51.
1391. gbcon52.seq - Constructed sequence entries, part 52.
1392. gbcon53.seq - Constructed sequence entries, part 53.
1393. gbcon54.seq - Constructed sequence entries, part 54.
1394. gbcon55.seq - Constructed sequence entries, part 55.
1395. gbcon56.seq - Constructed sequence entries, part 56.
1396. gbcon57.seq - Constructed sequence entries, part 57.
1397. gbcon58.seq - Constructed sequence entries, part 58.
1398. gbcon59.seq - Constructed sequence entries, part 59.
1399. gbcon6.seq - Constructed sequence entries, part 6.
1400. gbcon60.seq - Constructed sequence entries, part 60.
1401. gbcon61.seq - Constructed sequence entries, part 61.
1402. gbcon62.seq - Constructed sequence entries, part 62.
1403. gbcon63.seq - Constructed sequence entries, part 63.
1404. gbcon64.seq - Constructed sequence entries, part 64.
1405. gbcon65.seq - Constructed sequence entries, part 65.
1406. gbcon66.seq - Constructed sequence entries, part 66.
1407. gbcon67.seq - Constructed sequence entries, part 67.
1408. gbcon68.seq - Constructed sequence entries, part 68.
1409. gbcon69.seq - Constructed sequence entries, part 69.
1410. gbcon7.seq - Constructed sequence entries, part 7.
1411. gbcon70.seq - Constructed sequence entries, part 70.
1412. gbcon71.seq - Constructed sequence entries, part 71.
1413. gbcon72.seq - Constructed sequence entries, part 72.
1414. gbcon73.seq - Constructed sequence entries, part 73.
1415. gbcon74.seq - Constructed sequence entries, part 74.
1416. gbcon75.seq - Constructed sequence entries, part 75.
1417. gbcon76.seq - Constructed sequence entries, part 76.
1418. gbcon77.seq - Constructed sequence entries, part 77.
1419. gbcon78.seq - Constructed sequence entries, part 78.
1420. gbcon79.seq - Constructed sequence entries, part 79.
1421. gbcon8.seq - Constructed sequence entries, part 8.
1422. gbcon80.seq - Constructed sequence entries, part 80.
1423. gbcon81.seq - Constructed sequence entries, part 81.
1424. gbcon82.seq - Constructed sequence entries, part 82.
1425. gbcon83.seq - Constructed sequence entries, part 83.
1426. gbcon84.seq - Constructed sequence entries, part 84.
1427. gbcon85.seq - Constructed sequence entries, part 85.
1428. gbcon86.seq - Constructed sequence entries, part 86.
1429. gbcon87.seq - Constructed sequence entries, part 87.
1430. gbcon88.seq - Constructed sequence entries, part 88.
1431. gbcon89.seq - Constructed sequence entries, part 89.
1432. gbcon9.seq - Constructed sequence entries, part 9.
1433. gbcon90.seq - Constructed sequence entries, part 90.
1434. gbcon91.seq - Constructed sequence entries, part 91.
1435. gbcon92.seq - Constructed sequence entries, part 92.
1436. gbcon93.seq - Constructed sequence entries, part 93.
1437. gbcon94.seq - Constructed sequence entries, part 94.
1438. gbcon95.seq - Constructed sequence entries, part 95.
1439. gbcon96.seq - Constructed sequence entries, part 96.
1440. gbcon97.seq - Constructed sequence entries, part 97.
1441. gbcon98.seq - Constructed sequence entries, part 98.
1442. gbcon99.seq - Constructed sequence entries, part 99.
1443. gbdel.txt - Accession numbers of entries deleted since the previous release.
1444. gbenv1.seq - Environmental sampling sequence entries, part 1.
1445. gbenv10.seq - Environmental sampling sequence entries, part 10.
1446. gbenv11.seq - Environmental sampling sequence entries, part 11.
1447. gbenv12.seq - Environmental sampling sequence entries, part 12.
1448. gbenv13.seq - Environmental sampling sequence entries, part 13.
1449. gbenv14.seq - Environmental sampling sequence entries, part 14.
1450. gbenv15.seq - Environmental sampling sequence entries, part 15.
1451. gbenv16.seq - Environmental sampling sequence entries, part 16.
1452. gbenv17.seq - Environmental sampling sequence entries, part 17.
1453. gbenv18.seq - Environmental sampling sequence entries, part 18.
1454. gbenv19.seq - Environmental sampling sequence entries, part 19.
1455. gbenv2.seq - Environmental sampling sequence entries, part 2.
1456. gbenv20.seq - Environmental sampling sequence entries, part 20.
1457. gbenv21.seq - Environmental sampling sequence entries, part 21.
1458. gbenv22.seq - Environmental sampling sequence entries, part 22.
1459. gbenv23.seq - Environmental sampling sequence entries, part 23.
1460. gbenv24.seq - Environmental sampling sequence entries, part 24.
1461. gbenv25.seq - Environmental sampling sequence entries, part 25.
1462. gbenv26.seq - Environmental sampling sequence entries, part 26.
1463. gbenv27.seq - Environmental sampling sequence entries, part 27.
1464. gbenv28.seq - Environmental sampling sequence entries, part 28.
1465. gbenv29.seq - Environmental sampling sequence entries, part 29.
1466. gbenv3.seq - Environmental sampling sequence entries, part 3.
1467. gbenv30.seq - Environmental sampling sequence entries, part 30.
1468. gbenv31.seq - Environmental sampling sequence entries, part 31.
1469. gbenv32.seq - Environmental sampling sequence entries, part 32.
1470. gbenv33.seq - Environmental sampling sequence entries, part 33.
1471. gbenv34.seq - Environmental sampling sequence entries, part 34.
1472. gbenv35.seq - Environmental sampling sequence entries, part 35.
1473. gbenv36.seq - Environmental sampling sequence entries, part 36.
1474. gbenv37.seq - Environmental sampling sequence entries, part 37.
1475. gbenv38.seq - Environmental sampling sequence entries, part 38.
1476. gbenv39.seq - Environmental sampling sequence entries, part 39.
1477. gbenv4.seq - Environmental sampling sequence entries, part 4.
1478. gbenv40.seq - Environmental sampling sequence entries, part 40.
1479. gbenv41.seq - Environmental sampling sequence entries, part 41.
1480. gbenv42.seq - Environmental sampling sequence entries, part 42.
1481. gbenv43.seq - Environmental sampling sequence entries, part 43.
1482. gbenv44.seq - Environmental sampling sequence entries, part 44.
1483. gbenv45.seq - Environmental sampling sequence entries, part 45.
1484. gbenv46.seq - Environmental sampling sequence entries, part 46.
1485. gbenv47.seq - Environmental sampling sequence entries, part 47.
1486. gbenv48.seq - Environmental sampling sequence entries, part 48.
1487. gbenv49.seq - Environmental sampling sequence entries, part 49.
1488. gbenv5.seq - Environmental sampling sequence entries, part 5.
1489. gbenv50.seq - Environmental sampling sequence entries, part 50.
1490. gbenv51.seq - Environmental sampling sequence entries, part 51.
1491. gbenv52.seq - Environmental sampling sequence entries, part 52.
1492. gbenv53.seq - Environmental sampling sequence entries, part 53.
1493. gbenv54.seq - Environmental sampling sequence entries, part 54.
1494. gbenv55.seq - Environmental sampling sequence entries, part 55.
1495. gbenv56.seq - Environmental sampling sequence entries, part 56.
1496. gbenv57.seq - Environmental sampling sequence entries, part 57.
1497. gbenv58.seq - Environmental sampling sequence entries, part 58.
1498. gbenv59.seq - Environmental sampling sequence entries, part 59.
1499. gbenv6.seq - Environmental sampling sequence entries, part 6.
1500. gbenv60.seq - Environmental sampling sequence entries, part 60.
1501. gbenv61.seq - Environmental sampling sequence entries, part 61.
1502. gbenv62.seq - Environmental sampling sequence entries, part 62.
1503. gbenv63.seq - Environmental sampling sequence entries, part 63.
1504. gbenv64.seq - Environmental sampling sequence entries, part 64.
1505. gbenv65.seq - Environmental sampling sequence entries, part 65.
1506. gbenv66.seq - Environmental sampling sequence entries, part 66.
1507. gbenv67.seq - Environmental sampling sequence entries, part 67.
1508. gbenv68.seq - Environmental sampling sequence entries, part 68.
1509. gbenv69.seq - Environmental sampling sequence entries, part 69.
1510. gbenv7.seq - Environmental sampling sequence entries, part 7.
1511. gbenv70.seq - Environmental sampling sequence entries, part 70.
1512. gbenv71.seq - Environmental sampling sequence entries, part 71.
1513. gbenv72.seq - Environmental sampling sequence entries, part 72.
1514. gbenv73.seq - Environmental sampling sequence entries, part 73.
1515. gbenv74.seq - Environmental sampling sequence entries, part 74.
1516. gbenv75.seq - Environmental sampling sequence entries, part 75.
1517. gbenv76.seq - Environmental sampling sequence entries, part 76.
1518. gbenv77.seq - Environmental sampling sequence entries, part 77.
1519. gbenv78.seq - Environmental sampling sequence entries, part 78.
1520. gbenv79.seq - Environmental sampling sequence entries, part 79.
1521. gbenv8.seq - Environmental sampling sequence entries, part 8.
1522. gbenv80.seq - Environmental sampling sequence entries, part 80.
1523. gbenv81.seq - Environmental sampling sequence entries, part 81.
1524. gbenv82.seq - Environmental sampling sequence entries, part 82.
1525. gbenv83.seq - Environmental sampling sequence entries, part 83.
1526. gbenv84.seq - Environmental sampling sequence entries, part 84.
1527. gbenv85.seq - Environmental sampling sequence entries, part 85.
1528. gbenv86.seq - Environmental sampling sequence entries, part 86.
1529. gbenv87.seq - Environmental sampling sequence entries, part 87.
1530. gbenv88.seq - Environmental sampling sequence entries, part 88.
1531. gbenv89.seq - Environmental sampling sequence entries, part 89.
1532. gbenv9.seq - Environmental sampling sequence entries, part 9.
1533. gbenv90.seq - Environmental sampling sequence entries, part 90.
1534. gbenv91.seq - Environmental sampling sequence entries, part 91.
1535. gbenv92.seq - Environmental sampling sequence entries, part 92.
1536. gbenv93.seq - Environmental sampling sequence entries, part 93.
1537. gbenv94.seq - Environmental sampling sequence entries, part 94.
1538. gbenv95.seq - Environmental sampling sequence entries, part 95.
1539. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1540. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1541. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1542. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1543. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1544. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1545. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1546. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1547. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1548. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1549. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1550. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1551. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1552. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1553. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1554. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1555. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1556. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1557. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1558. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1559. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1560. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1561. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1562. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1563. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1564. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1565. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1566. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1567. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1568. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1569. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1570. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1571. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1572. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1573. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1574. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1575. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1576. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1577. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1578. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1579. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1580. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1581. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1582. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1583. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1584. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1585. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1586. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1587. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1588. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1589. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1590. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1591. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1592. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1593. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1594. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1595. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1596. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1597. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1598. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1599. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1600. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1601. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1602. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1603. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1604. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1605. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1606. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1607. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1608. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1609. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1610. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1611. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1612. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1613. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1614. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1615. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1616. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1617. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1618. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1619. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1620. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1621. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1622. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1623. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1624. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1625. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1626. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1627. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1628. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1629. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1630. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1631. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1632. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1633. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1634. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1635. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1636. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1637. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1638. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1639. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1640. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1641. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1642. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1643. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1644. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1645. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1646. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1647. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1648. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1649. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1650. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1651. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1652. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1653. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1654. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1655. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1656. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1657. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1658. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1659. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1660. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1661. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1662. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1663. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1664. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1665. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1666. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1667. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1668. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1669. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1670. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1671. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1672. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1673. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1674. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1675. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1676. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1677. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1678. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1679. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1680. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1681. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1682. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1683. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1684. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1685. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1686. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1687. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1688. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1689. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1690. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1691. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1692. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1693. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1694. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1695. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1696. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1697. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1698. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1699. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1700. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1701. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1702. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1703. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1704. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1705. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1706. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1707. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1708. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1709. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1710. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1711. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1712. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1713. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1714. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1715. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1716. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1717. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1718. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1719. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1720. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1721. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1722. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1723. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1724. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1725. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1726. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1727. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1728. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1729. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1730. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1731. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1732. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1733. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1734. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1735. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1736. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1737. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1738. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1739. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1740. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1741. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1742. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1743. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1744. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1745. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1746. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1747. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1748. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1749. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1750. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1751. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1752. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1753. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1754. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1755. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1756. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1757. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1758. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1759. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1760. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1761. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1762. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1763. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1764. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1765. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1766. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1767. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1768. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1769. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1770. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1771. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1772. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1773. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1774. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1775. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1776. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1777. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1778. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1779. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1780. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1781. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1782. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1783. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1784. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1785. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1786. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1787. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1788. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1789. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1790. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1791. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1792. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1793. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1794. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1795. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1796. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1797. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1798. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1799. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1800. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1801. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1802. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1803. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1804. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1805. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1806. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1807. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1808. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1809. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1810. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1811. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1812. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1813. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1814. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1815. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1816. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1817. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1818. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1819. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1820. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1821. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1822. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1823. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1824. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1825. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1826. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1827. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1828. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1829. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1830. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1831. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1832. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1833. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1834. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1835. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1836. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1837. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1838. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1839. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1840. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1841. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1842. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1843. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1844. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1845. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1846. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1847. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1848. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1849. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1850. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1851. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1852. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1853. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1854. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1855. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1856. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1857. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1858. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1859. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1860. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1861. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1862. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1863. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1864. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1865. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1866. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1867. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1868. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1869. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1870. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1871. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1872. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1873. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1874. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1875. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1876. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1877. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1878. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1879. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1880. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1881. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1882. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1883. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1884. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1885. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1886. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1887. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1888. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1889. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1890. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1891. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1892. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1893. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1894. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1895. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1896. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1897. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1898. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1899. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1900. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1901. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1902. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1903. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1904. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1905. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1906. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1907. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1908. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1909. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1910. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1911. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1912. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1913. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1914. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1915. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1916. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1917. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1918. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1919. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1920. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1921. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1922. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1923. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1924. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1925. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1926. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1927. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1928. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1929. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1930. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1931. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1932. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1933. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1934. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1935. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1936. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1937. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1938. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1939. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1940. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1941. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1942. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1943. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1944. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1945. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1946. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1947. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1948. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1949. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1950. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1951. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1952. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1953. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1954. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1955. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1956. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1957. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1958. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1959. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1960. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1961. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1962. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1963. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1964. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1965. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1966. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1967. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1968. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1969. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1970. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1971. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1972. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1973. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1974. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1975. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1976. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1977. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1978. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1979. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1980. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1981. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1982. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1983. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1984. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1985. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1986. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1987. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1988. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1989. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1990. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1991. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1992. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1993. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1994. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1995. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1996. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1997. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1998. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1999. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
2000. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
2001. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
2002. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
2003. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
2004. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
2005. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
2006. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
2007. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
2008. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
2009. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
2010. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
2011. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
2012. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
2013. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
2014. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
2015. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
2016. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
2017. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
2018. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
2019. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
2020. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
2021. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
2022. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
2023. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
2024. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
2025. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
2026. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
2027. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
2028. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
2029. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
2030. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
2031. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
2032. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
2033. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
2034. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
2035. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
2036. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
2037. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
2038. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
2039. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
2040. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
2041. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
2042. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
2043. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
2044. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
2045. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
2046. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
2047. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
2048. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
2049. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
2050. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
2051. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
2052. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
2053. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
2054. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
2055. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
2056. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
2057. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
2058. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
2059. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
2060. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
2061. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
2062. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
2063. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
2064. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
2065. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
2066. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
2067. gbest575.seq - EST (expressed sequence tag) sequence entries, part 575.
2068. gbest576.seq - EST (expressed sequence tag) sequence entries, part 576.
2069. gbest577.seq - EST (expressed sequence tag) sequence entries, part 577.
2070. gbest578.seq - EST (expressed sequence tag) sequence entries, part 578.
2071. gbest579.seq - EST (expressed sequence tag) sequence entries, part 579.
2072. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
2073. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
2074. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
2075. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
2076. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
2077. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
2078. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
2079. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
2080. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
2081. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
2082. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
2083. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
2084. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
2085. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
2086. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
2087. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
2088. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
2089. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
2090. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
2091. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
2092. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
2093. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
2094. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
2095. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
2096. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
2097. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
2098. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
2099. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
2100. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
2101. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
2102. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
2103. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
2104. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
2105. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
2106. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
2107. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
2108. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
2109. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
2110. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
2111. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
2112. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
2113. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
2114. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
2115. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
2116. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
2117. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
2118. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
2119. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
2120. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
2121. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
2122. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
2123. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
2124. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
2125. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
2126. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
2127. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
2128. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
2129. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
2130. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
2131. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
2132. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
2133. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
2134. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
2135. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
2136. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
2137. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
2138. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
2139. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
2140. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
2141. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
2142. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
2143. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
2144. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
2145. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
2146. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
2147. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
2148. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
2149. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
2150. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
2151. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
2152. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
2153. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
2154. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
2155. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
2156. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
2157. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
2158. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
2159. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
2160. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
2161. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
2162. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
2163. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
2164. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
2165. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
2166. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
2167. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
2168. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
2169. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
2170. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
2171. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
2172. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
2173. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
2174. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
2175. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
2176. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
2177. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
2178. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
2179. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
2180. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
2181. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
2182. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
2183. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
2184. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
2185. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
2186. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
2187. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
2188. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
2189. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
2190. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
2191. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
2192. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
2193. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
2194. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
2195. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
2196. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
2197. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
2198. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
2199. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
2200. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
2201. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
2202. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
2203. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
2204. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
2205. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
2206. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
2207. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
2208. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
2209. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
2210. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
2211. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
2212. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
2213. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
2214. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
2215. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
2216. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
2217. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
2218. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
2219. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
2220. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
2221. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
2222. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
2223. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
2224. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
2225. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
2226. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
2227. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
2228. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
2229. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
2230. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
2231. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
2232. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
2233. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
2234. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
2235. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
2236. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
2237. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
2238. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
2239. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
2240. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
2241. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
2242. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
2243. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
2244. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
2245. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
2246. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
2247. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
2248. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
2249. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
2250. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
2251. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
2252. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
2253. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
2254. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
2255. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
2256. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
2257. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
2258. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
2259. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
2260. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
2261. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
2262. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
2263. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
2264. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
2265. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
2266. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
2267. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
2268. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
2269. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
2270. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
2271. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
2272. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
2273. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
2274. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
2275. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
2276. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
2277. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
2278. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
2279. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
2280. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
2281. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
2282. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
2283. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
2284. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
2285. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
2286. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
2287. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
2288. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
2289. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
2290. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
2291. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
2292. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
2293. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
2294. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
2295. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
2296. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
2297. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
2298. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
2299. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
2300. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
2301. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
2302. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
2303. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
2304. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
2305. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
2306. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
2307. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
2308. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
2309. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
2310. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
2311. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
2312. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
2313. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
2314. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
2315. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
2316. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
2317. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
2318. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
2319. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
2320. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
2321. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
2322. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
2323. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
2324. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
2325. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
2326. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
2327. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
2328. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
2329. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
2330. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
2331. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
2332. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
2333. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
2334. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
2335. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
2336. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
2337. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
2338. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
2339. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
2340. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
2341. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
2342. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
2343. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
2344. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
2345. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
2346. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
2347. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
2348. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
2349. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
2350. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
2351. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
2352. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
2353. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
2354. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
2355. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
2356. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
2357. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
2358. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
2359. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
2360. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
2361. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
2362. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
2363. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
2364. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
2365. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
2366. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
2367. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
2368. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
2369. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
2370. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
2371. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
2372. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
2373. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
2374. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
2375. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
2376. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
2377. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
2378. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
2379. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
2380. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
2381. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
2382. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
2383. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
2384. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
2385. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
2386. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
2387. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
2388. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
2389. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
2390. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
2391. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
2392. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
2393. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
2394. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
2395. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
2396. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
2397. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
2398. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
2399. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
2400. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
2401. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
2402. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
2403. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
2404. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
2405. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
2406. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
2407. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
2408. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
2409. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
2410. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
2411. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
2412. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
2413. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
2414. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
2415. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
2416. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
2417. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
2418. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
2419. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
2420. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
2421. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
2422. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
2423. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
2424. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
2425. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
2426. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
2427. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
2428. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
2429. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
2430. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
2431. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
2432. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
2433. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
2434. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
2435. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
2436. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
2437. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
2438. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
2439. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
2440. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
2441. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
2442. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
2443. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
2444. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
2445. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
2446. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
2447. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
2448. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
2449. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
2450. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
2451. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
2452. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
2453. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
2454. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
2455. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
2456. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
2457. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
2458. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
2459. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
2460. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
2461. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
2462. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
2463. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
2464. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
2465. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
2466. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
2467. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
2468. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
2469. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
2470. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
2471. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
2472. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
2473. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
2474. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
2475. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
2476. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
2477. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2478. gbinv1.seq - Invertebrate sequence entries, part 1.
2479. gbinv10.seq - Invertebrate sequence entries, part 10.
2480. gbinv100.seq - Invertebrate sequence entries, part 100.
2481. gbinv1000.seq - Invertebrate sequence entries, part 1000.
2482. gbinv1001.seq - Invertebrate sequence entries, part 1001.
2483. gbinv1002.seq - Invertebrate sequence entries, part 1002.
2484. gbinv1003.seq - Invertebrate sequence entries, part 1003.
2485. gbinv1004.seq - Invertebrate sequence entries, part 1004.
2486. gbinv1005.seq - Invertebrate sequence entries, part 1005.
2487. gbinv1006.seq - Invertebrate sequence entries, part 1006.
2488. gbinv1007.seq - Invertebrate sequence entries, part 1007.
2489. gbinv1008.seq - Invertebrate sequence entries, part 1008.
2490. gbinv1009.seq - Invertebrate sequence entries, part 1009.
2491. gbinv101.seq - Invertebrate sequence entries, part 101.
2492. gbinv1010.seq - Invertebrate sequence entries, part 1010.
2493. gbinv1011.seq - Invertebrate sequence entries, part 1011.
2494. gbinv1012.seq - Invertebrate sequence entries, part 1012.
2495. gbinv1013.seq - Invertebrate sequence entries, part 1013.
2496. gbinv1014.seq - Invertebrate sequence entries, part 1014.
2497. gbinv1015.seq - Invertebrate sequence entries, part 1015.
2498. gbinv1016.seq - Invertebrate sequence entries, part 1016.
2499. gbinv1017.seq - Invertebrate sequence entries, part 1017.
2500. gbinv1018.seq - Invertebrate sequence entries, part 1018.
2501. gbinv1019.seq - Invertebrate sequence entries, part 1019.
2502. gbinv102.seq - Invertebrate sequence entries, part 102.
2503. gbinv1020.seq - Invertebrate sequence entries, part 1020.
2504. gbinv1021.seq - Invertebrate sequence entries, part 1021.
2505. gbinv1022.seq - Invertebrate sequence entries, part 1022.
2506. gbinv1023.seq - Invertebrate sequence entries, part 1023.
2507. gbinv1024.seq - Invertebrate sequence entries, part 1024.
2508. gbinv1025.seq - Invertebrate sequence entries, part 1025.
2509. gbinv1026.seq - Invertebrate sequence entries, part 1026.
2510. gbinv1027.seq - Invertebrate sequence entries, part 1027.
2511. gbinv1028.seq - Invertebrate sequence entries, part 1028.
2512. gbinv1029.seq - Invertebrate sequence entries, part 1029.
2513. gbinv103.seq - Invertebrate sequence entries, part 103.
2514. gbinv1030.seq - Invertebrate sequence entries, part 1030.
2515. gbinv1031.seq - Invertebrate sequence entries, part 1031.
2516. gbinv1032.seq - Invertebrate sequence entries, part 1032.
2517. gbinv1033.seq - Invertebrate sequence entries, part 1033.
2518. gbinv1034.seq - Invertebrate sequence entries, part 1034.
2519. gbinv1035.seq - Invertebrate sequence entries, part 1035.
2520. gbinv1036.seq - Invertebrate sequence entries, part 1036.
2521. gbinv1037.seq - Invertebrate sequence entries, part 1037.
2522. gbinv1038.seq - Invertebrate sequence entries, part 1038.
2523. gbinv1039.seq - Invertebrate sequence entries, part 1039.
2524. gbinv104.seq - Invertebrate sequence entries, part 104.
2525. gbinv1040.seq - Invertebrate sequence entries, part 1040.
2526. gbinv1041.seq - Invertebrate sequence entries, part 1041.
2527. gbinv1042.seq - Invertebrate sequence entries, part 1042.
2528. gbinv1043.seq - Invertebrate sequence entries, part 1043.
2529. gbinv1044.seq - Invertebrate sequence entries, part 1044.
2530. gbinv1045.seq - Invertebrate sequence entries, part 1045.
2531. gbinv1046.seq - Invertebrate sequence entries, part 1046.
2532. gbinv1047.seq - Invertebrate sequence entries, part 1047.
2533. gbinv1048.seq - Invertebrate sequence entries, part 1048.
2534. gbinv1049.seq - Invertebrate sequence entries, part 1049.
2535. gbinv105.seq - Invertebrate sequence entries, part 105.
2536. gbinv1050.seq - Invertebrate sequence entries, part 1050.
2537. gbinv1051.seq - Invertebrate sequence entries, part 1051.
2538. gbinv1052.seq - Invertebrate sequence entries, part 1052.
2539. gbinv1053.seq - Invertebrate sequence entries, part 1053.
2540. gbinv1054.seq - Invertebrate sequence entries, part 1054.
2541. gbinv1055.seq - Invertebrate sequence entries, part 1055.
2542. gbinv1056.seq - Invertebrate sequence entries, part 1056.
2543. gbinv1057.seq - Invertebrate sequence entries, part 1057.
2544. gbinv1058.seq - Invertebrate sequence entries, part 1058.
2545. gbinv1059.seq - Invertebrate sequence entries, part 1059.
2546. gbinv106.seq - Invertebrate sequence entries, part 106.
2547. gbinv1060.seq - Invertebrate sequence entries, part 1060.
2548. gbinv1061.seq - Invertebrate sequence entries, part 1061.
2549. gbinv1062.seq - Invertebrate sequence entries, part 1062.
2550. gbinv1063.seq - Invertebrate sequence entries, part 1063.
2551. gbinv1064.seq - Invertebrate sequence entries, part 1064.
2552. gbinv1065.seq - Invertebrate sequence entries, part 1065.
2553. gbinv1066.seq - Invertebrate sequence entries, part 1066.
2554. gbinv1067.seq - Invertebrate sequence entries, part 1067.
2555. gbinv1068.seq - Invertebrate sequence entries, part 1068.
2556. gbinv1069.seq - Invertebrate sequence entries, part 1069.
2557. gbinv107.seq - Invertebrate sequence entries, part 107.
2558. gbinv1070.seq - Invertebrate sequence entries, part 1070.
2559. gbinv1071.seq - Invertebrate sequence entries, part 1071.
2560. gbinv1072.seq - Invertebrate sequence entries, part 1072.
2561. gbinv1073.seq - Invertebrate sequence entries, part 1073.
2562. gbinv1074.seq - Invertebrate sequence entries, part 1074.
2563. gbinv1075.seq - Invertebrate sequence entries, part 1075.
2564. gbinv1076.seq - Invertebrate sequence entries, part 1076.
2565. gbinv1077.seq - Invertebrate sequence entries, part 1077.
2566. gbinv1078.seq - Invertebrate sequence entries, part 1078.
2567. gbinv1079.seq - Invertebrate sequence entries, part 1079.
2568. gbinv108.seq - Invertebrate sequence entries, part 108.
2569. gbinv1080.seq - Invertebrate sequence entries, part 1080.
2570. gbinv1081.seq - Invertebrate sequence entries, part 1081.
2571. gbinv1082.seq - Invertebrate sequence entries, part 1082.
2572. gbinv1083.seq - Invertebrate sequence entries, part 1083.
2573. gbinv1084.seq - Invertebrate sequence entries, part 1084.
2574. gbinv1085.seq - Invertebrate sequence entries, part 1085.
2575. gbinv1086.seq - Invertebrate sequence entries, part 1086.
2576. gbinv1087.seq - Invertebrate sequence entries, part 1087.
2577. gbinv1088.seq - Invertebrate sequence entries, part 1088.
2578. gbinv1089.seq - Invertebrate sequence entries, part 1089.
2579. gbinv109.seq - Invertebrate sequence entries, part 109.
2580. gbinv1090.seq - Invertebrate sequence entries, part 1090.
2581. gbinv1091.seq - Invertebrate sequence entries, part 1091.
2582. gbinv1092.seq - Invertebrate sequence entries, part 1092.
2583. gbinv1093.seq - Invertebrate sequence entries, part 1093.
2584. gbinv1094.seq - Invertebrate sequence entries, part 1094.
2585. gbinv1095.seq - Invertebrate sequence entries, part 1095.
2586. gbinv1096.seq - Invertebrate sequence entries, part 1096.
2587. gbinv1097.seq - Invertebrate sequence entries, part 1097.
2588. gbinv1098.seq - Invertebrate sequence entries, part 1098.
2589. gbinv1099.seq - Invertebrate sequence entries, part 1099.
2590. gbinv11.seq - Invertebrate sequence entries, part 11.
2591. gbinv110.seq - Invertebrate sequence entries, part 110.
2592. gbinv1100.seq - Invertebrate sequence entries, part 1100.
2593. gbinv1101.seq - Invertebrate sequence entries, part 1101.
2594. gbinv1102.seq - Invertebrate sequence entries, part 1102.
2595. gbinv1103.seq - Invertebrate sequence entries, part 1103.
2596. gbinv1104.seq - Invertebrate sequence entries, part 1104.
2597. gbinv1105.seq - Invertebrate sequence entries, part 1105.
2598. gbinv1106.seq - Invertebrate sequence entries, part 1106.
2599. gbinv1107.seq - Invertebrate sequence entries, part 1107.
2600. gbinv1108.seq - Invertebrate sequence entries, part 1108.
2601. gbinv1109.seq - Invertebrate sequence entries, part 1109.
2602. gbinv111.seq - Invertebrate sequence entries, part 111.
2603. gbinv1110.seq - Invertebrate sequence entries, part 1110.
2604. gbinv1111.seq - Invertebrate sequence entries, part 1111.
2605. gbinv1112.seq - Invertebrate sequence entries, part 1112.
2606. gbinv1113.seq - Invertebrate sequence entries, part 1113.
2607. gbinv1114.seq - Invertebrate sequence entries, part 1114.
2608. gbinv1115.seq - Invertebrate sequence entries, part 1115.
2609. gbinv1116.seq - Invertebrate sequence entries, part 1116.
2610. gbinv1117.seq - Invertebrate sequence entries, part 1117.
2611. gbinv1118.seq - Invertebrate sequence entries, part 1118.
2612. gbinv1119.seq - Invertebrate sequence entries, part 1119.
2613. gbinv112.seq - Invertebrate sequence entries, part 112.
2614. gbinv1120.seq - Invertebrate sequence entries, part 1120.
2615. gbinv1121.seq - Invertebrate sequence entries, part 1121.
2616. gbinv1122.seq - Invertebrate sequence entries, part 1122.
2617. gbinv1123.seq - Invertebrate sequence entries, part 1123.
2618. gbinv1124.seq - Invertebrate sequence entries, part 1124.
2619. gbinv1125.seq - Invertebrate sequence entries, part 1125.
2620. gbinv1126.seq - Invertebrate sequence entries, part 1126.
2621. gbinv1127.seq - Invertebrate sequence entries, part 1127.
2622. gbinv1128.seq - Invertebrate sequence entries, part 1128.
2623. gbinv1129.seq - Invertebrate sequence entries, part 1129.
2624. gbinv113.seq - Invertebrate sequence entries, part 113.
2625. gbinv1130.seq - Invertebrate sequence entries, part 1130.
2626. gbinv1131.seq - Invertebrate sequence entries, part 1131.
2627. gbinv1132.seq - Invertebrate sequence entries, part 1132.
2628. gbinv1133.seq - Invertebrate sequence entries, part 1133.
2629. gbinv1134.seq - Invertebrate sequence entries, part 1134.
2630. gbinv1135.seq - Invertebrate sequence entries, part 1135.
2631. gbinv1136.seq - Invertebrate sequence entries, part 1136.
2632. gbinv1137.seq - Invertebrate sequence entries, part 1137.
2633. gbinv1138.seq - Invertebrate sequence entries, part 1138.
2634. gbinv1139.seq - Invertebrate sequence entries, part 1139.
2635. gbinv114.seq - Invertebrate sequence entries, part 114.
2636. gbinv1140.seq - Invertebrate sequence entries, part 1140.
2637. gbinv1141.seq - Invertebrate sequence entries, part 1141.
2638. gbinv1142.seq - Invertebrate sequence entries, part 1142.
2639. gbinv1143.seq - Invertebrate sequence entries, part 1143.
2640. gbinv1144.seq - Invertebrate sequence entries, part 1144.
2641. gbinv1145.seq - Invertebrate sequence entries, part 1145.
2642. gbinv1146.seq - Invertebrate sequence entries, part 1146.
2643. gbinv1147.seq - Invertebrate sequence entries, part 1147.
2644. gbinv1148.seq - Invertebrate sequence entries, part 1148.
2645. gbinv1149.seq - Invertebrate sequence entries, part 1149.
2646. gbinv115.seq - Invertebrate sequence entries, part 115.
2647. gbinv1150.seq - Invertebrate sequence entries, part 1150.
2648. gbinv1151.seq - Invertebrate sequence entries, part 1151.
2649. gbinv1152.seq - Invertebrate sequence entries, part 1152.
2650. gbinv1153.seq - Invertebrate sequence entries, part 1153.
2651. gbinv1154.seq - Invertebrate sequence entries, part 1154.
2652. gbinv1155.seq - Invertebrate sequence entries, part 1155.
2653. gbinv1156.seq - Invertebrate sequence entries, part 1156.
2654. gbinv1157.seq - Invertebrate sequence entries, part 1157.
2655. gbinv1158.seq - Invertebrate sequence entries, part 1158.
2656. gbinv1159.seq - Invertebrate sequence entries, part 1159.
2657. gbinv116.seq - Invertebrate sequence entries, part 116.
2658. gbinv1160.seq - Invertebrate sequence entries, part 1160.
2659. gbinv1161.seq - Invertebrate sequence entries, part 1161.
2660. gbinv1162.seq - Invertebrate sequence entries, part 1162.
2661. gbinv1163.seq - Invertebrate sequence entries, part 1163.
2662. gbinv1164.seq - Invertebrate sequence entries, part 1164.
2663. gbinv1165.seq - Invertebrate sequence entries, part 1165.
2664. gbinv1166.seq - Invertebrate sequence entries, part 1166.
2665. gbinv1167.seq - Invertebrate sequence entries, part 1167.
2666. gbinv1168.seq - Invertebrate sequence entries, part 1168.
2667. gbinv1169.seq - Invertebrate sequence entries, part 1169.
2668. gbinv117.seq - Invertebrate sequence entries, part 117.
2669. gbinv1170.seq - Invertebrate sequence entries, part 1170.
2670. gbinv1171.seq - Invertebrate sequence entries, part 1171.
2671. gbinv1172.seq - Invertebrate sequence entries, part 1172.
2672. gbinv1173.seq - Invertebrate sequence entries, part 1173.
2673. gbinv1174.seq - Invertebrate sequence entries, part 1174.
2674. gbinv1175.seq - Invertebrate sequence entries, part 1175.
2675. gbinv1176.seq - Invertebrate sequence entries, part 1176.
2676. gbinv1177.seq - Invertebrate sequence entries, part 1177.
2677. gbinv1178.seq - Invertebrate sequence entries, part 1178.
2678. gbinv1179.seq - Invertebrate sequence entries, part 1179.
2679. gbinv118.seq - Invertebrate sequence entries, part 118.
2680. gbinv1180.seq - Invertebrate sequence entries, part 1180.
2681. gbinv1181.seq - Invertebrate sequence entries, part 1181.
2682. gbinv1182.seq - Invertebrate sequence entries, part 1182.
2683. gbinv1183.seq - Invertebrate sequence entries, part 1183.
2684. gbinv1184.seq - Invertebrate sequence entries, part 1184.
2685. gbinv1185.seq - Invertebrate sequence entries, part 1185.
2686. gbinv1186.seq - Invertebrate sequence entries, part 1186.
2687. gbinv1187.seq - Invertebrate sequence entries, part 1187.
2688. gbinv1188.seq - Invertebrate sequence entries, part 1188.
2689. gbinv1189.seq - Invertebrate sequence entries, part 1189.
2690. gbinv119.seq - Invertebrate sequence entries, part 119.
2691. gbinv1190.seq - Invertebrate sequence entries, part 1190.
2692. gbinv1191.seq - Invertebrate sequence entries, part 1191.
2693. gbinv1192.seq - Invertebrate sequence entries, part 1192.
2694. gbinv1193.seq - Invertebrate sequence entries, part 1193.
2695. gbinv1194.seq - Invertebrate sequence entries, part 1194.
2696. gbinv1195.seq - Invertebrate sequence entries, part 1195.
2697. gbinv1196.seq - Invertebrate sequence entries, part 1196.
2698. gbinv1197.seq - Invertebrate sequence entries, part 1197.
2699. gbinv1198.seq - Invertebrate sequence entries, part 1198.
2700. gbinv1199.seq - Invertebrate sequence entries, part 1199.
2701. gbinv12.seq - Invertebrate sequence entries, part 12.
2702. gbinv120.seq - Invertebrate sequence entries, part 120.
2703. gbinv1200.seq - Invertebrate sequence entries, part 1200.
2704. gbinv1201.seq - Invertebrate sequence entries, part 1201.
2705. gbinv1202.seq - Invertebrate sequence entries, part 1202.
2706. gbinv1203.seq - Invertebrate sequence entries, part 1203.
2707. gbinv1204.seq - Invertebrate sequence entries, part 1204.
2708. gbinv1205.seq - Invertebrate sequence entries, part 1205.
2709. gbinv1206.seq - Invertebrate sequence entries, part 1206.
2710. gbinv1207.seq - Invertebrate sequence entries, part 1207.
2711. gbinv1208.seq - Invertebrate sequence entries, part 1208.
2712. gbinv1209.seq - Invertebrate sequence entries, part 1209.
2713. gbinv121.seq - Invertebrate sequence entries, part 121.
2714. gbinv1210.seq - Invertebrate sequence entries, part 1210.
2715. gbinv1211.seq - Invertebrate sequence entries, part 1211.
2716. gbinv1212.seq - Invertebrate sequence entries, part 1212.
2717. gbinv1213.seq - Invertebrate sequence entries, part 1213.
2718. gbinv1214.seq - Invertebrate sequence entries, part 1214.
2719. gbinv1215.seq - Invertebrate sequence entries, part 1215.
2720. gbinv1216.seq - Invertebrate sequence entries, part 1216.
2721. gbinv1217.seq - Invertebrate sequence entries, part 1217.
2722. gbinv1218.seq - Invertebrate sequence entries, part 1218.
2723. gbinv1219.seq - Invertebrate sequence entries, part 1219.
2724. gbinv122.seq - Invertebrate sequence entries, part 122.
2725. gbinv1220.seq - Invertebrate sequence entries, part 1220.
2726. gbinv1221.seq - Invertebrate sequence entries, part 1221.
2727. gbinv1222.seq - Invertebrate sequence entries, part 1222.
2728. gbinv1223.seq - Invertebrate sequence entries, part 1223.
2729. gbinv1224.seq - Invertebrate sequence entries, part 1224.
2730. gbinv1225.seq - Invertebrate sequence entries, part 1225.
2731. gbinv1226.seq - Invertebrate sequence entries, part 1226.
2732. gbinv1227.seq - Invertebrate sequence entries, part 1227.
2733. gbinv1228.seq - Invertebrate sequence entries, part 1228.
2734. gbinv1229.seq - Invertebrate sequence entries, part 1229.
2735. gbinv123.seq - Invertebrate sequence entries, part 123.
2736. gbinv1230.seq - Invertebrate sequence entries, part 1230.
2737. gbinv1231.seq - Invertebrate sequence entries, part 1231.
2738. gbinv1232.seq - Invertebrate sequence entries, part 1232.
2739. gbinv1233.seq - Invertebrate sequence entries, part 1233.
2740. gbinv1234.seq - Invertebrate sequence entries, part 1234.
2741. gbinv1235.seq - Invertebrate sequence entries, part 1235.
2742. gbinv1236.seq - Invertebrate sequence entries, part 1236.
2743. gbinv1237.seq - Invertebrate sequence entries, part 1237.
2744. gbinv1238.seq - Invertebrate sequence entries, part 1238.
2745. gbinv1239.seq - Invertebrate sequence entries, part 1239.
2746. gbinv124.seq - Invertebrate sequence entries, part 124.
2747. gbinv1240.seq - Invertebrate sequence entries, part 1240.
2748. gbinv1241.seq - Invertebrate sequence entries, part 1241.
2749. gbinv1242.seq - Invertebrate sequence entries, part 1242.
2750. gbinv1243.seq - Invertebrate sequence entries, part 1243.
2751. gbinv1244.seq - Invertebrate sequence entries, part 1244.
2752. gbinv1245.seq - Invertebrate sequence entries, part 1245.
2753. gbinv1246.seq - Invertebrate sequence entries, part 1246.
2754. gbinv1247.seq - Invertebrate sequence entries, part 1247.
2755. gbinv1248.seq - Invertebrate sequence entries, part 1248.
2756. gbinv1249.seq - Invertebrate sequence entries, part 1249.
2757. gbinv125.seq - Invertebrate sequence entries, part 125.
2758. gbinv1250.seq - Invertebrate sequence entries, part 1250.
2759. gbinv1251.seq - Invertebrate sequence entries, part 1251.
2760. gbinv1252.seq - Invertebrate sequence entries, part 1252.
2761. gbinv1253.seq - Invertebrate sequence entries, part 1253.
2762. gbinv1254.seq - Invertebrate sequence entries, part 1254.
2763. gbinv1255.seq - Invertebrate sequence entries, part 1255.
2764. gbinv1256.seq - Invertebrate sequence entries, part 1256.
2765. gbinv1257.seq - Invertebrate sequence entries, part 1257.
2766. gbinv1258.seq - Invertebrate sequence entries, part 1258.
2767. gbinv1259.seq - Invertebrate sequence entries, part 1259.
2768. gbinv126.seq - Invertebrate sequence entries, part 126.
2769. gbinv1260.seq - Invertebrate sequence entries, part 1260.
2770. gbinv1261.seq - Invertebrate sequence entries, part 1261.
2771. gbinv1262.seq - Invertebrate sequence entries, part 1262.
2772. gbinv1263.seq - Invertebrate sequence entries, part 1263.
2773. gbinv1264.seq - Invertebrate sequence entries, part 1264.
2774. gbinv1265.seq - Invertebrate sequence entries, part 1265.
2775. gbinv1266.seq - Invertebrate sequence entries, part 1266.
2776. gbinv1267.seq - Invertebrate sequence entries, part 1267.
2777. gbinv1268.seq - Invertebrate sequence entries, part 1268.
2778. gbinv1269.seq - Invertebrate sequence entries, part 1269.
2779. gbinv127.seq - Invertebrate sequence entries, part 127.
2780. gbinv1270.seq - Invertebrate sequence entries, part 1270.
2781. gbinv1271.seq - Invertebrate sequence entries, part 1271.
2782. gbinv1272.seq - Invertebrate sequence entries, part 1272.
2783. gbinv1273.seq - Invertebrate sequence entries, part 1273.
2784. gbinv1274.seq - Invertebrate sequence entries, part 1274.
2785. gbinv1275.seq - Invertebrate sequence entries, part 1275.
2786. gbinv1276.seq - Invertebrate sequence entries, part 1276.
2787. gbinv1277.seq - Invertebrate sequence entries, part 1277.
2788. gbinv1278.seq - Invertebrate sequence entries, part 1278.
2789. gbinv1279.seq - Invertebrate sequence entries, part 1279.
2790. gbinv128.seq - Invertebrate sequence entries, part 128.
2791. gbinv1280.seq - Invertebrate sequence entries, part 1280.
2792. gbinv1281.seq - Invertebrate sequence entries, part 1281.
2793. gbinv1282.seq - Invertebrate sequence entries, part 1282.
2794. gbinv1283.seq - Invertebrate sequence entries, part 1283.
2795. gbinv1284.seq - Invertebrate sequence entries, part 1284.
2796. gbinv1285.seq - Invertebrate sequence entries, part 1285.
2797. gbinv1286.seq - Invertebrate sequence entries, part 1286.
2798. gbinv1287.seq - Invertebrate sequence entries, part 1287.
2799. gbinv1288.seq - Invertebrate sequence entries, part 1288.
2800. gbinv1289.seq - Invertebrate sequence entries, part 1289.
2801. gbinv129.seq - Invertebrate sequence entries, part 129.
2802. gbinv1290.seq - Invertebrate sequence entries, part 1290.
2803. gbinv1291.seq - Invertebrate sequence entries, part 1291.
2804. gbinv1292.seq - Invertebrate sequence entries, part 1292.
2805. gbinv1293.seq - Invertebrate sequence entries, part 1293.
2806. gbinv1294.seq - Invertebrate sequence entries, part 1294.
2807. gbinv1295.seq - Invertebrate sequence entries, part 1295.
2808. gbinv1296.seq - Invertebrate sequence entries, part 1296.
2809. gbinv1297.seq - Invertebrate sequence entries, part 1297.
2810. gbinv1298.seq - Invertebrate sequence entries, part 1298.
2811. gbinv1299.seq - Invertebrate sequence entries, part 1299.
2812. gbinv13.seq - Invertebrate sequence entries, part 13.
2813. gbinv130.seq - Invertebrate sequence entries, part 130.
2814. gbinv1300.seq - Invertebrate sequence entries, part 1300.
2815. gbinv1301.seq - Invertebrate sequence entries, part 1301.
2816. gbinv1302.seq - Invertebrate sequence entries, part 1302.
2817. gbinv1303.seq - Invertebrate sequence entries, part 1303.
2818. gbinv1304.seq - Invertebrate sequence entries, part 1304.
2819. gbinv1305.seq - Invertebrate sequence entries, part 1305.
2820. gbinv1306.seq - Invertebrate sequence entries, part 1306.
2821. gbinv1307.seq - Invertebrate sequence entries, part 1307.
2822. gbinv1308.seq - Invertebrate sequence entries, part 1308.
2823. gbinv1309.seq - Invertebrate sequence entries, part 1309.
2824. gbinv131.seq - Invertebrate sequence entries, part 131.
2825. gbinv1310.seq - Invertebrate sequence entries, part 1310.
2826. gbinv1311.seq - Invertebrate sequence entries, part 1311.
2827. gbinv1312.seq - Invertebrate sequence entries, part 1312.
2828. gbinv1313.seq - Invertebrate sequence entries, part 1313.
2829. gbinv1314.seq - Invertebrate sequence entries, part 1314.
2830. gbinv1315.seq - Invertebrate sequence entries, part 1315.
2831. gbinv1316.seq - Invertebrate sequence entries, part 1316.
2832. gbinv1317.seq - Invertebrate sequence entries, part 1317.
2833. gbinv1318.seq - Invertebrate sequence entries, part 1318.
2834. gbinv1319.seq - Invertebrate sequence entries, part 1319.
2835. gbinv132.seq - Invertebrate sequence entries, part 132.
2836. gbinv1320.seq - Invertebrate sequence entries, part 1320.
2837. gbinv1321.seq - Invertebrate sequence entries, part 1321.
2838. gbinv1322.seq - Invertebrate sequence entries, part 1322.
2839. gbinv1323.seq - Invertebrate sequence entries, part 1323.
2840. gbinv1324.seq - Invertebrate sequence entries, part 1324.
2841. gbinv1325.seq - Invertebrate sequence entries, part 1325.
2842. gbinv1326.seq - Invertebrate sequence entries, part 1326.
2843. gbinv1327.seq - Invertebrate sequence entries, part 1327.
2844. gbinv1328.seq - Invertebrate sequence entries, part 1328.
2845. gbinv1329.seq - Invertebrate sequence entries, part 1329.
2846. gbinv133.seq - Invertebrate sequence entries, part 133.
2847. gbinv1330.seq - Invertebrate sequence entries, part 1330.
2848. gbinv1331.seq - Invertebrate sequence entries, part 1331.
2849. gbinv1332.seq - Invertebrate sequence entries, part 1332.
2850. gbinv1333.seq - Invertebrate sequence entries, part 1333.
2851. gbinv1334.seq - Invertebrate sequence entries, part 1334.
2852. gbinv1335.seq - Invertebrate sequence entries, part 1335.
2853. gbinv1336.seq - Invertebrate sequence entries, part 1336.
2854. gbinv1337.seq - Invertebrate sequence entries, part 1337.
2855. gbinv1338.seq - Invertebrate sequence entries, part 1338.
2856. gbinv1339.seq - Invertebrate sequence entries, part 1339.
2857. gbinv134.seq - Invertebrate sequence entries, part 134.
2858. gbinv1340.seq - Invertebrate sequence entries, part 1340.
2859. gbinv1341.seq - Invertebrate sequence entries, part 1341.
2860. gbinv1342.seq - Invertebrate sequence entries, part 1342.
2861. gbinv1343.seq - Invertebrate sequence entries, part 1343.
2862. gbinv1344.seq - Invertebrate sequence entries, part 1344.
2863. gbinv1345.seq - Invertebrate sequence entries, part 1345.
2864. gbinv1346.seq - Invertebrate sequence entries, part 1346.
2865. gbinv1347.seq - Invertebrate sequence entries, part 1347.
2866. gbinv1348.seq - Invertebrate sequence entries, part 1348.
2867. gbinv1349.seq - Invertebrate sequence entries, part 1349.
2868. gbinv135.seq - Invertebrate sequence entries, part 135.
2869. gbinv1350.seq - Invertebrate sequence entries, part 1350.
2870. gbinv1351.seq - Invertebrate sequence entries, part 1351.
2871. gbinv1352.seq - Invertebrate sequence entries, part 1352.
2872. gbinv1353.seq - Invertebrate sequence entries, part 1353.
2873. gbinv1354.seq - Invertebrate sequence entries, part 1354.
2874. gbinv1355.seq - Invertebrate sequence entries, part 1355.
2875. gbinv1356.seq - Invertebrate sequence entries, part 1356.
2876. gbinv1357.seq - Invertebrate sequence entries, part 1357.
2877. gbinv1358.seq - Invertebrate sequence entries, part 1358.
2878. gbinv1359.seq - Invertebrate sequence entries, part 1359.
2879. gbinv136.seq - Invertebrate sequence entries, part 136.
2880. gbinv1360.seq - Invertebrate sequence entries, part 1360.
2881. gbinv1361.seq - Invertebrate sequence entries, part 1361.
2882. gbinv1362.seq - Invertebrate sequence entries, part 1362.
2883. gbinv1363.seq - Invertebrate sequence entries, part 1363.
2884. gbinv1364.seq - Invertebrate sequence entries, part 1364.
2885. gbinv1365.seq - Invertebrate sequence entries, part 1365.
2886. gbinv1366.seq - Invertebrate sequence entries, part 1366.
2887. gbinv1367.seq - Invertebrate sequence entries, part 1367.
2888. gbinv1368.seq - Invertebrate sequence entries, part 1368.
2889. gbinv1369.seq - Invertebrate sequence entries, part 1369.
2890. gbinv137.seq - Invertebrate sequence entries, part 137.
2891. gbinv1370.seq - Invertebrate sequence entries, part 1370.
2892. gbinv1371.seq - Invertebrate sequence entries, part 1371.
2893. gbinv1372.seq - Invertebrate sequence entries, part 1372.
2894. gbinv1373.seq - Invertebrate sequence entries, part 1373.
2895. gbinv1374.seq - Invertebrate sequence entries, part 1374.
2896. gbinv1375.seq - Invertebrate sequence entries, part 1375.
2897. gbinv1376.seq - Invertebrate sequence entries, part 1376.
2898. gbinv1377.seq - Invertebrate sequence entries, part 1377.
2899. gbinv1378.seq - Invertebrate sequence entries, part 1378.
2900. gbinv1379.seq - Invertebrate sequence entries, part 1379.
2901. gbinv138.seq - Invertebrate sequence entries, part 138.
2902. gbinv1380.seq - Invertebrate sequence entries, part 1380.
2903. gbinv1381.seq - Invertebrate sequence entries, part 1381.
2904. gbinv1382.seq - Invertebrate sequence entries, part 1382.
2905. gbinv1383.seq - Invertebrate sequence entries, part 1383.
2906. gbinv1384.seq - Invertebrate sequence entries, part 1384.
2907. gbinv1385.seq - Invertebrate sequence entries, part 1385.
2908. gbinv1386.seq - Invertebrate sequence entries, part 1386.
2909. gbinv1387.seq - Invertebrate sequence entries, part 1387.
2910. gbinv1388.seq - Invertebrate sequence entries, part 1388.
2911. gbinv1389.seq - Invertebrate sequence entries, part 1389.
2912. gbinv139.seq - Invertebrate sequence entries, part 139.
2913. gbinv1390.seq - Invertebrate sequence entries, part 1390.
2914. gbinv1391.seq - Invertebrate sequence entries, part 1391.
2915. gbinv1392.seq - Invertebrate sequence entries, part 1392.
2916. gbinv1393.seq - Invertebrate sequence entries, part 1393.
2917. gbinv1394.seq - Invertebrate sequence entries, part 1394.
2918. gbinv1395.seq - Invertebrate sequence entries, part 1395.
2919. gbinv1396.seq - Invertebrate sequence entries, part 1396.
2920. gbinv1397.seq - Invertebrate sequence entries, part 1397.
2921. gbinv1398.seq - Invertebrate sequence entries, part 1398.
2922. gbinv1399.seq - Invertebrate sequence entries, part 1399.
2923. gbinv14.seq - Invertebrate sequence entries, part 14.
2924. gbinv140.seq - Invertebrate sequence entries, part 140.
2925. gbinv1400.seq - Invertebrate sequence entries, part 1400.
2926. gbinv1401.seq - Invertebrate sequence entries, part 1401.
2927. gbinv1402.seq - Invertebrate sequence entries, part 1402.
2928. gbinv1403.seq - Invertebrate sequence entries, part 1403.
2929. gbinv1404.seq - Invertebrate sequence entries, part 1404.
2930. gbinv1405.seq - Invertebrate sequence entries, part 1405.
2931. gbinv1406.seq - Invertebrate sequence entries, part 1406.
2932. gbinv1407.seq - Invertebrate sequence entries, part 1407.
2933. gbinv1408.seq - Invertebrate sequence entries, part 1408.
2934. gbinv1409.seq - Invertebrate sequence entries, part 1409.
2935. gbinv141.seq - Invertebrate sequence entries, part 141.
2936. gbinv1410.seq - Invertebrate sequence entries, part 1410.
2937. gbinv1411.seq - Invertebrate sequence entries, part 1411.
2938. gbinv1412.seq - Invertebrate sequence entries, part 1412.
2939. gbinv1413.seq - Invertebrate sequence entries, part 1413.
2940. gbinv1414.seq - Invertebrate sequence entries, part 1414.
2941. gbinv1415.seq - Invertebrate sequence entries, part 1415.
2942. gbinv1416.seq - Invertebrate sequence entries, part 1416.
2943. gbinv1417.seq - Invertebrate sequence entries, part 1417.
2944. gbinv1418.seq - Invertebrate sequence entries, part 1418.
2945. gbinv1419.seq - Invertebrate sequence entries, part 1419.
2946. gbinv142.seq - Invertebrate sequence entries, part 142.
2947. gbinv1420.seq - Invertebrate sequence entries, part 1420.
2948. gbinv1421.seq - Invertebrate sequence entries, part 1421.
2949. gbinv1422.seq - Invertebrate sequence entries, part 1422.
2950. gbinv1423.seq - Invertebrate sequence entries, part 1423.
2951. gbinv1424.seq - Invertebrate sequence entries, part 1424.
2952. gbinv1425.seq - Invertebrate sequence entries, part 1425.
2953. gbinv1426.seq - Invertebrate sequence entries, part 1426.
2954. gbinv1427.seq - Invertebrate sequence entries, part 1427.
2955. gbinv1428.seq - Invertebrate sequence entries, part 1428.
2956. gbinv1429.seq - Invertebrate sequence entries, part 1429.
2957. gbinv143.seq - Invertebrate sequence entries, part 143.
2958. gbinv1430.seq - Invertebrate sequence entries, part 1430.
2959. gbinv1431.seq - Invertebrate sequence entries, part 1431.
2960. gbinv1432.seq - Invertebrate sequence entries, part 1432.
2961. gbinv1433.seq - Invertebrate sequence entries, part 1433.
2962. gbinv1434.seq - Invertebrate sequence entries, part 1434.
2963. gbinv1435.seq - Invertebrate sequence entries, part 1435.
2964. gbinv1436.seq - Invertebrate sequence entries, part 1436.
2965. gbinv1437.seq - Invertebrate sequence entries, part 1437.
2966. gbinv1438.seq - Invertebrate sequence entries, part 1438.
2967. gbinv1439.seq - Invertebrate sequence entries, part 1439.
2968. gbinv144.seq - Invertebrate sequence entries, part 144.
2969. gbinv1440.seq - Invertebrate sequence entries, part 1440.
2970. gbinv1441.seq - Invertebrate sequence entries, part 1441.
2971. gbinv1442.seq - Invertebrate sequence entries, part 1442.
2972. gbinv1443.seq - Invertebrate sequence entries, part 1443.
2973. gbinv1444.seq - Invertebrate sequence entries, part 1444.
2974. gbinv1445.seq - Invertebrate sequence entries, part 1445.
2975. gbinv1446.seq - Invertebrate sequence entries, part 1446.
2976. gbinv1447.seq - Invertebrate sequence entries, part 1447.
2977. gbinv1448.seq - Invertebrate sequence entries, part 1448.
2978. gbinv1449.seq - Invertebrate sequence entries, part 1449.
2979. gbinv145.seq - Invertebrate sequence entries, part 145.
2980. gbinv1450.seq - Invertebrate sequence entries, part 1450.
2981. gbinv1451.seq - Invertebrate sequence entries, part 1451.
2982. gbinv1452.seq - Invertebrate sequence entries, part 1452.
2983. gbinv1453.seq - Invertebrate sequence entries, part 1453.
2984. gbinv1454.seq - Invertebrate sequence entries, part 1454.
2985. gbinv1455.seq - Invertebrate sequence entries, part 1455.
2986. gbinv1456.seq - Invertebrate sequence entries, part 1456.
2987. gbinv1457.seq - Invertebrate sequence entries, part 1457.
2988. gbinv1458.seq - Invertebrate sequence entries, part 1458.
2989. gbinv1459.seq - Invertebrate sequence entries, part 1459.
2990. gbinv146.seq - Invertebrate sequence entries, part 146.
2991. gbinv1460.seq - Invertebrate sequence entries, part 1460.
2992. gbinv1461.seq - Invertebrate sequence entries, part 1461.
2993. gbinv1462.seq - Invertebrate sequence entries, part 1462.
2994. gbinv1463.seq - Invertebrate sequence entries, part 1463.
2995. gbinv1464.seq - Invertebrate sequence entries, part 1464.
2996. gbinv1465.seq - Invertebrate sequence entries, part 1465.
2997. gbinv1466.seq - Invertebrate sequence entries, part 1466.
2998. gbinv1467.seq - Invertebrate sequence entries, part 1467.
2999. gbinv1468.seq - Invertebrate sequence entries, part 1468.
3000. gbinv1469.seq - Invertebrate sequence entries, part 1469.
3001. gbinv147.seq - Invertebrate sequence entries, part 147.
3002. gbinv1470.seq - Invertebrate sequence entries, part 1470.
3003. gbinv1471.seq - Invertebrate sequence entries, part 1471.
3004. gbinv1472.seq - Invertebrate sequence entries, part 1472.
3005. gbinv1473.seq - Invertebrate sequence entries, part 1473.
3006. gbinv1474.seq - Invertebrate sequence entries, part 1474.
3007. gbinv1475.seq - Invertebrate sequence entries, part 1475.
3008. gbinv1476.seq - Invertebrate sequence entries, part 1476.
3009. gbinv1477.seq - Invertebrate sequence entries, part 1477.
3010. gbinv1478.seq - Invertebrate sequence entries, part 1478.
3011. gbinv1479.seq - Invertebrate sequence entries, part 1479.
3012. gbinv148.seq - Invertebrate sequence entries, part 148.
3013. gbinv1480.seq - Invertebrate sequence entries, part 1480.
3014. gbinv1481.seq - Invertebrate sequence entries, part 1481.
3015. gbinv1482.seq - Invertebrate sequence entries, part 1482.
3016. gbinv1483.seq - Invertebrate sequence entries, part 1483.
3017. gbinv1484.seq - Invertebrate sequence entries, part 1484.
3018. gbinv1485.seq - Invertebrate sequence entries, part 1485.
3019. gbinv1486.seq - Invertebrate sequence entries, part 1486.
3020. gbinv1487.seq - Invertebrate sequence entries, part 1487.
3021. gbinv1488.seq - Invertebrate sequence entries, part 1488.
3022. gbinv1489.seq - Invertebrate sequence entries, part 1489.
3023. gbinv149.seq - Invertebrate sequence entries, part 149.
3024. gbinv1490.seq - Invertebrate sequence entries, part 1490.
3025. gbinv1491.seq - Invertebrate sequence entries, part 1491.
3026. gbinv1492.seq - Invertebrate sequence entries, part 1492.
3027. gbinv1493.seq - Invertebrate sequence entries, part 1493.
3028. gbinv1494.seq - Invertebrate sequence entries, part 1494.
3029. gbinv1495.seq - Invertebrate sequence entries, part 1495.
3030. gbinv1496.seq - Invertebrate sequence entries, part 1496.
3031. gbinv1497.seq - Invertebrate sequence entries, part 1497.
3032. gbinv1498.seq - Invertebrate sequence entries, part 1498.
3033. gbinv1499.seq - Invertebrate sequence entries, part 1499.
3034. gbinv15.seq - Invertebrate sequence entries, part 15.
3035. gbinv150.seq - Invertebrate sequence entries, part 150.
3036. gbinv1500.seq - Invertebrate sequence entries, part 1500.
3037. gbinv1501.seq - Invertebrate sequence entries, part 1501.
3038. gbinv1502.seq - Invertebrate sequence entries, part 1502.
3039. gbinv1503.seq - Invertebrate sequence entries, part 1503.
3040. gbinv1504.seq - Invertebrate sequence entries, part 1504.
3041. gbinv1505.seq - Invertebrate sequence entries, part 1505.
3042. gbinv1506.seq - Invertebrate sequence entries, part 1506.
3043. gbinv1507.seq - Invertebrate sequence entries, part 1507.
3044. gbinv1508.seq - Invertebrate sequence entries, part 1508.
3045. gbinv1509.seq - Invertebrate sequence entries, part 1509.
3046. gbinv151.seq - Invertebrate sequence entries, part 151.
3047. gbinv1510.seq - Invertebrate sequence entries, part 1510.
3048. gbinv1511.seq - Invertebrate sequence entries, part 1511.
3049. gbinv1512.seq - Invertebrate sequence entries, part 1512.
3050. gbinv1513.seq - Invertebrate sequence entries, part 1513.
3051. gbinv1514.seq - Invertebrate sequence entries, part 1514.
3052. gbinv1515.seq - Invertebrate sequence entries, part 1515.
3053. gbinv1516.seq - Invertebrate sequence entries, part 1516.
3054. gbinv1517.seq - Invertebrate sequence entries, part 1517.
3055. gbinv1518.seq - Invertebrate sequence entries, part 1518.
3056. gbinv1519.seq - Invertebrate sequence entries, part 1519.
3057. gbinv152.seq - Invertebrate sequence entries, part 152.
3058. gbinv1520.seq - Invertebrate sequence entries, part 1520.
3059. gbinv1521.seq - Invertebrate sequence entries, part 1521.
3060. gbinv1522.seq - Invertebrate sequence entries, part 1522.
3061. gbinv1523.seq - Invertebrate sequence entries, part 1523.
3062. gbinv1524.seq - Invertebrate sequence entries, part 1524.
3063. gbinv1525.seq - Invertebrate sequence entries, part 1525.
3064. gbinv1526.seq - Invertebrate sequence entries, part 1526.
3065. gbinv1527.seq - Invertebrate sequence entries, part 1527.
3066. gbinv1528.seq - Invertebrate sequence entries, part 1528.
3067. gbinv1529.seq - Invertebrate sequence entries, part 1529.
3068. gbinv153.seq - Invertebrate sequence entries, part 153.
3069. gbinv1530.seq - Invertebrate sequence entries, part 1530.
3070. gbinv1531.seq - Invertebrate sequence entries, part 1531.
3071. gbinv1532.seq - Invertebrate sequence entries, part 1532.
3072. gbinv1533.seq - Invertebrate sequence entries, part 1533.
3073. gbinv1534.seq - Invertebrate sequence entries, part 1534.
3074. gbinv1535.seq - Invertebrate sequence entries, part 1535.
3075. gbinv1536.seq - Invertebrate sequence entries, part 1536.
3076. gbinv1537.seq - Invertebrate sequence entries, part 1537.
3077. gbinv1538.seq - Invertebrate sequence entries, part 1538.
3078. gbinv1539.seq - Invertebrate sequence entries, part 1539.
3079. gbinv154.seq - Invertebrate sequence entries, part 154.
3080. gbinv1540.seq - Invertebrate sequence entries, part 1540.
3081. gbinv1541.seq - Invertebrate sequence entries, part 1541.
3082. gbinv1542.seq - Invertebrate sequence entries, part 1542.
3083. gbinv1543.seq - Invertebrate sequence entries, part 1543.
3084. gbinv1544.seq - Invertebrate sequence entries, part 1544.
3085. gbinv1545.seq - Invertebrate sequence entries, part 1545.
3086. gbinv1546.seq - Invertebrate sequence entries, part 1546.
3087. gbinv1547.seq - Invertebrate sequence entries, part 1547.
3088. gbinv1548.seq - Invertebrate sequence entries, part 1548.
3089. gbinv1549.seq - Invertebrate sequence entries, part 1549.
3090. gbinv155.seq - Invertebrate sequence entries, part 155.
3091. gbinv1550.seq - Invertebrate sequence entries, part 1550.
3092. gbinv1551.seq - Invertebrate sequence entries, part 1551.
3093. gbinv1552.seq - Invertebrate sequence entries, part 1552.
3094. gbinv1553.seq - Invertebrate sequence entries, part 1553.
3095. gbinv1554.seq - Invertebrate sequence entries, part 1554.
3096. gbinv1555.seq - Invertebrate sequence entries, part 1555.
3097. gbinv1556.seq - Invertebrate sequence entries, part 1556.
3098. gbinv1557.seq - Invertebrate sequence entries, part 1557.
3099. gbinv1558.seq - Invertebrate sequence entries, part 1558.
3100. gbinv1559.seq - Invertebrate sequence entries, part 1559.
3101. gbinv156.seq - Invertebrate sequence entries, part 156.
3102. gbinv1560.seq - Invertebrate sequence entries, part 1560.
3103. gbinv1561.seq - Invertebrate sequence entries, part 1561.
3104. gbinv1562.seq - Invertebrate sequence entries, part 1562.
3105. gbinv1563.seq - Invertebrate sequence entries, part 1563.
3106. gbinv1564.seq - Invertebrate sequence entries, part 1564.
3107. gbinv1565.seq - Invertebrate sequence entries, part 1565.
3108. gbinv1566.seq - Invertebrate sequence entries, part 1566.
3109. gbinv1567.seq - Invertebrate sequence entries, part 1567.
3110. gbinv1568.seq - Invertebrate sequence entries, part 1568.
3111. gbinv1569.seq - Invertebrate sequence entries, part 1569.
3112. gbinv157.seq - Invertebrate sequence entries, part 157.
3113. gbinv1570.seq - Invertebrate sequence entries, part 1570.
3114. gbinv1571.seq - Invertebrate sequence entries, part 1571.
3115. gbinv1572.seq - Invertebrate sequence entries, part 1572.
3116. gbinv1573.seq - Invertebrate sequence entries, part 1573.
3117. gbinv1574.seq - Invertebrate sequence entries, part 1574.
3118. gbinv1575.seq - Invertebrate sequence entries, part 1575.
3119. gbinv1576.seq - Invertebrate sequence entries, part 1576.
3120. gbinv1577.seq - Invertebrate sequence entries, part 1577.
3121. gbinv1578.seq - Invertebrate sequence entries, part 1578.
3122. gbinv1579.seq - Invertebrate sequence entries, part 1579.
3123. gbinv158.seq - Invertebrate sequence entries, part 158.
3124. gbinv1580.seq - Invertebrate sequence entries, part 1580.
3125. gbinv1581.seq - Invertebrate sequence entries, part 1581.
3126. gbinv1582.seq - Invertebrate sequence entries, part 1582.
3127. gbinv1583.seq - Invertebrate sequence entries, part 1583.
3128. gbinv1584.seq - Invertebrate sequence entries, part 1584.
3129. gbinv1585.seq - Invertebrate sequence entries, part 1585.
3130. gbinv1586.seq - Invertebrate sequence entries, part 1586.
3131. gbinv1587.seq - Invertebrate sequence entries, part 1587.
3132. gbinv1588.seq - Invertebrate sequence entries, part 1588.
3133. gbinv1589.seq - Invertebrate sequence entries, part 1589.
3134. gbinv159.seq - Invertebrate sequence entries, part 159.
3135. gbinv1590.seq - Invertebrate sequence entries, part 1590.
3136. gbinv1591.seq - Invertebrate sequence entries, part 1591.
3137. gbinv1592.seq - Invertebrate sequence entries, part 1592.
3138. gbinv1593.seq - Invertebrate sequence entries, part 1593.
3139. gbinv1594.seq - Invertebrate sequence entries, part 1594.
3140. gbinv1595.seq - Invertebrate sequence entries, part 1595.
3141. gbinv1596.seq - Invertebrate sequence entries, part 1596.
3142. gbinv1597.seq - Invertebrate sequence entries, part 1597.
3143. gbinv1598.seq - Invertebrate sequence entries, part 1598.
3144. gbinv1599.seq - Invertebrate sequence entries, part 1599.
3145. gbinv16.seq - Invertebrate sequence entries, part 16.
3146. gbinv160.seq - Invertebrate sequence entries, part 160.
3147. gbinv1600.seq - Invertebrate sequence entries, part 1600.
3148. gbinv1601.seq - Invertebrate sequence entries, part 1601.
3149. gbinv1602.seq - Invertebrate sequence entries, part 1602.
3150. gbinv1603.seq - Invertebrate sequence entries, part 1603.
3151. gbinv1604.seq - Invertebrate sequence entries, part 1604.
3152. gbinv1605.seq - Invertebrate sequence entries, part 1605.
3153. gbinv1606.seq - Invertebrate sequence entries, part 1606.
3154. gbinv1607.seq - Invertebrate sequence entries, part 1607.
3155. gbinv1608.seq - Invertebrate sequence entries, part 1608.
3156. gbinv1609.seq - Invertebrate sequence entries, part 1609.
3157. gbinv161.seq - Invertebrate sequence entries, part 161.
3158. gbinv1610.seq - Invertebrate sequence entries, part 1610.
3159. gbinv1611.seq - Invertebrate sequence entries, part 1611.
3160. gbinv1612.seq - Invertebrate sequence entries, part 1612.
3161. gbinv1613.seq - Invertebrate sequence entries, part 1613.
3162. gbinv1614.seq - Invertebrate sequence entries, part 1614.
3163. gbinv1615.seq - Invertebrate sequence entries, part 1615.
3164. gbinv1616.seq - Invertebrate sequence entries, part 1616.
3165. gbinv1617.seq - Invertebrate sequence entries, part 1617.
3166. gbinv1618.seq - Invertebrate sequence entries, part 1618.
3167. gbinv1619.seq - Invertebrate sequence entries, part 1619.
3168. gbinv162.seq - Invertebrate sequence entries, part 162.
3169. gbinv1620.seq - Invertebrate sequence entries, part 1620.
3170. gbinv1621.seq - Invertebrate sequence entries, part 1621.
3171. gbinv1622.seq - Invertebrate sequence entries, part 1622.
3172. gbinv1623.seq - Invertebrate sequence entries, part 1623.
3173. gbinv1624.seq - Invertebrate sequence entries, part 1624.
3174. gbinv1625.seq - Invertebrate sequence entries, part 1625.
3175. gbinv1626.seq - Invertebrate sequence entries, part 1626.
3176. gbinv1627.seq - Invertebrate sequence entries, part 1627.
3177. gbinv1628.seq - Invertebrate sequence entries, part 1628.
3178. gbinv1629.seq - Invertebrate sequence entries, part 1629.
3179. gbinv163.seq - Invertebrate sequence entries, part 163.
3180. gbinv1630.seq - Invertebrate sequence entries, part 1630.
3181. gbinv1631.seq - Invertebrate sequence entries, part 1631.
3182. gbinv1632.seq - Invertebrate sequence entries, part 1632.
3183. gbinv1633.seq - Invertebrate sequence entries, part 1633.
3184. gbinv1634.seq - Invertebrate sequence entries, part 1634.
3185. gbinv1635.seq - Invertebrate sequence entries, part 1635.
3186. gbinv1636.seq - Invertebrate sequence entries, part 1636.
3187. gbinv1637.seq - Invertebrate sequence entries, part 1637.
3188. gbinv1638.seq - Invertebrate sequence entries, part 1638.
3189. gbinv1639.seq - Invertebrate sequence entries, part 1639.
3190. gbinv164.seq - Invertebrate sequence entries, part 164.
3191. gbinv1640.seq - Invertebrate sequence entries, part 1640.
3192. gbinv1641.seq - Invertebrate sequence entries, part 1641.
3193. gbinv1642.seq - Invertebrate sequence entries, part 1642.
3194. gbinv1643.seq - Invertebrate sequence entries, part 1643.
3195. gbinv1644.seq - Invertebrate sequence entries, part 1644.
3196. gbinv1645.seq - Invertebrate sequence entries, part 1645.
3197. gbinv1646.seq - Invertebrate sequence entries, part 1646.
3198. gbinv1647.seq - Invertebrate sequence entries, part 1647.
3199. gbinv1648.seq - Invertebrate sequence entries, part 1648.
3200. gbinv1649.seq - Invertebrate sequence entries, part 1649.
3201. gbinv165.seq - Invertebrate sequence entries, part 165.
3202. gbinv1650.seq - Invertebrate sequence entries, part 1650.
3203. gbinv1651.seq - Invertebrate sequence entries, part 1651.
3204. gbinv1652.seq - Invertebrate sequence entries, part 1652.
3205. gbinv1653.seq - Invertebrate sequence entries, part 1653.
3206. gbinv1654.seq - Invertebrate sequence entries, part 1654.
3207. gbinv1655.seq - Invertebrate sequence entries, part 1655.
3208. gbinv1656.seq - Invertebrate sequence entries, part 1656.
3209. gbinv1657.seq - Invertebrate sequence entries, part 1657.
3210. gbinv1658.seq - Invertebrate sequence entries, part 1658.
3211. gbinv1659.seq - Invertebrate sequence entries, part 1659.
3212. gbinv166.seq - Invertebrate sequence entries, part 166.
3213. gbinv1660.seq - Invertebrate sequence entries, part 1660.
3214. gbinv1661.seq - Invertebrate sequence entries, part 1661.
3215. gbinv1662.seq - Invertebrate sequence entries, part 1662.
3216. gbinv1663.seq - Invertebrate sequence entries, part 1663.
3217. gbinv1664.seq - Invertebrate sequence entries, part 1664.
3218. gbinv1665.seq - Invertebrate sequence entries, part 1665.
3219. gbinv1666.seq - Invertebrate sequence entries, part 1666.
3220. gbinv1667.seq - Invertebrate sequence entries, part 1667.
3221. gbinv1668.seq - Invertebrate sequence entries, part 1668.
3222. gbinv1669.seq - Invertebrate sequence entries, part 1669.
3223. gbinv167.seq - Invertebrate sequence entries, part 167.
3224. gbinv1670.seq - Invertebrate sequence entries, part 1670.
3225. gbinv1671.seq - Invertebrate sequence entries, part 1671.
3226. gbinv1672.seq - Invertebrate sequence entries, part 1672.
3227. gbinv1673.seq - Invertebrate sequence entries, part 1673.
3228. gbinv1674.seq - Invertebrate sequence entries, part 1674.
3229. gbinv1675.seq - Invertebrate sequence entries, part 1675.
3230. gbinv1676.seq - Invertebrate sequence entries, part 1676.
3231. gbinv1677.seq - Invertebrate sequence entries, part 1677.
3232. gbinv1678.seq - Invertebrate sequence entries, part 1678.
3233. gbinv1679.seq - Invertebrate sequence entries, part 1679.
3234. gbinv168.seq - Invertebrate sequence entries, part 168.
3235. gbinv1680.seq - Invertebrate sequence entries, part 1680.
3236. gbinv1681.seq - Invertebrate sequence entries, part 1681.
3237. gbinv1682.seq - Invertebrate sequence entries, part 1682.
3238. gbinv1683.seq - Invertebrate sequence entries, part 1683.
3239. gbinv1684.seq - Invertebrate sequence entries, part 1684.
3240. gbinv1685.seq - Invertebrate sequence entries, part 1685.
3241. gbinv1686.seq - Invertebrate sequence entries, part 1686.
3242. gbinv1687.seq - Invertebrate sequence entries, part 1687.
3243. gbinv1688.seq - Invertebrate sequence entries, part 1688.
3244. gbinv1689.seq - Invertebrate sequence entries, part 1689.
3245. gbinv169.seq - Invertebrate sequence entries, part 169.
3246. gbinv1690.seq - Invertebrate sequence entries, part 1690.
3247. gbinv1691.seq - Invertebrate sequence entries, part 1691.
3248. gbinv1692.seq - Invertebrate sequence entries, part 1692.
3249. gbinv1693.seq - Invertebrate sequence entries, part 1693.
3250. gbinv1694.seq - Invertebrate sequence entries, part 1694.
3251. gbinv1695.seq - Invertebrate sequence entries, part 1695.
3252. gbinv1696.seq - Invertebrate sequence entries, part 1696.
3253. gbinv1697.seq - Invertebrate sequence entries, part 1697.
3254. gbinv1698.seq - Invertebrate sequence entries, part 1698.
3255. gbinv1699.seq - Invertebrate sequence entries, part 1699.
3256. gbinv17.seq - Invertebrate sequence entries, part 17.
3257. gbinv170.seq - Invertebrate sequence entries, part 170.
3258. gbinv1700.seq - Invertebrate sequence entries, part 1700.
3259. gbinv1701.seq - Invertebrate sequence entries, part 1701.
3260. gbinv1702.seq - Invertebrate sequence entries, part 1702.
3261. gbinv1703.seq - Invertebrate sequence entries, part 1703.
3262. gbinv1704.seq - Invertebrate sequence entries, part 1704.
3263. gbinv1705.seq - Invertebrate sequence entries, part 1705.
3264. gbinv1706.seq - Invertebrate sequence entries, part 1706.
3265. gbinv1707.seq - Invertebrate sequence entries, part 1707.
3266. gbinv1708.seq - Invertebrate sequence entries, part 1708.
3267. gbinv1709.seq - Invertebrate sequence entries, part 1709.
3268. gbinv171.seq - Invertebrate sequence entries, part 171.
3269. gbinv1710.seq - Invertebrate sequence entries, part 1710.
3270. gbinv1711.seq - Invertebrate sequence entries, part 1711.
3271. gbinv1712.seq - Invertebrate sequence entries, part 1712.
3272. gbinv1713.seq - Invertebrate sequence entries, part 1713.
3273. gbinv1714.seq - Invertebrate sequence entries, part 1714.
3274. gbinv1715.seq - Invertebrate sequence entries, part 1715.
3275. gbinv1716.seq - Invertebrate sequence entries, part 1716.
3276. gbinv1717.seq - Invertebrate sequence entries, part 1717.
3277. gbinv1718.seq - Invertebrate sequence entries, part 1718.
3278. gbinv1719.seq - Invertebrate sequence entries, part 1719.
3279. gbinv172.seq - Invertebrate sequence entries, part 172.
3280. gbinv1720.seq - Invertebrate sequence entries, part 1720.
3281. gbinv1721.seq - Invertebrate sequence entries, part 1721.
3282. gbinv1722.seq - Invertebrate sequence entries, part 1722.
3283. gbinv1723.seq - Invertebrate sequence entries, part 1723.
3284. gbinv1724.seq - Invertebrate sequence entries, part 1724.
3285. gbinv1725.seq - Invertebrate sequence entries, part 1725.
3286. gbinv1726.seq - Invertebrate sequence entries, part 1726.
3287. gbinv1727.seq - Invertebrate sequence entries, part 1727.
3288. gbinv1728.seq - Invertebrate sequence entries, part 1728.
3289. gbinv1729.seq - Invertebrate sequence entries, part 1729.
3290. gbinv173.seq - Invertebrate sequence entries, part 173.
3291. gbinv1730.seq - Invertebrate sequence entries, part 1730.
3292. gbinv1731.seq - Invertebrate sequence entries, part 1731.
3293. gbinv1732.seq - Invertebrate sequence entries, part 1732.
3294. gbinv1733.seq - Invertebrate sequence entries, part 1733.
3295. gbinv1734.seq - Invertebrate sequence entries, part 1734.
3296. gbinv1735.seq - Invertebrate sequence entries, part 1735.
3297. gbinv1736.seq - Invertebrate sequence entries, part 1736.
3298. gbinv1737.seq - Invertebrate sequence entries, part 1737.
3299. gbinv1738.seq - Invertebrate sequence entries, part 1738.
3300. gbinv1739.seq - Invertebrate sequence entries, part 1739.
3301. gbinv174.seq - Invertebrate sequence entries, part 174.
3302. gbinv1740.seq - Invertebrate sequence entries, part 1740.
3303. gbinv1741.seq - Invertebrate sequence entries, part 1741.
3304. gbinv1742.seq - Invertebrate sequence entries, part 1742.
3305. gbinv1743.seq - Invertebrate sequence entries, part 1743.
3306. gbinv1744.seq - Invertebrate sequence entries, part 1744.
3307. gbinv1745.seq - Invertebrate sequence entries, part 1745.
3308. gbinv1746.seq - Invertebrate sequence entries, part 1746.
3309. gbinv1747.seq - Invertebrate sequence entries, part 1747.
3310. gbinv1748.seq - Invertebrate sequence entries, part 1748.
3311. gbinv1749.seq - Invertebrate sequence entries, part 1749.
3312. gbinv175.seq - Invertebrate sequence entries, part 175.
3313. gbinv1750.seq - Invertebrate sequence entries, part 1750.
3314. gbinv1751.seq - Invertebrate sequence entries, part 1751.
3315. gbinv1752.seq - Invertebrate sequence entries, part 1752.
3316. gbinv1753.seq - Invertebrate sequence entries, part 1753.
3317. gbinv1754.seq - Invertebrate sequence entries, part 1754.
3318. gbinv1755.seq - Invertebrate sequence entries, part 1755.
3319. gbinv1756.seq - Invertebrate sequence entries, part 1756.
3320. gbinv1757.seq - Invertebrate sequence entries, part 1757.
3321. gbinv1758.seq - Invertebrate sequence entries, part 1758.
3322. gbinv1759.seq - Invertebrate sequence entries, part 1759.
3323. gbinv176.seq - Invertebrate sequence entries, part 176.
3324. gbinv1760.seq - Invertebrate sequence entries, part 1760.
3325. gbinv1761.seq - Invertebrate sequence entries, part 1761.
3326. gbinv1762.seq - Invertebrate sequence entries, part 1762.
3327. gbinv1763.seq - Invertebrate sequence entries, part 1763.
3328. gbinv1764.seq - Invertebrate sequence entries, part 1764.
3329. gbinv1765.seq - Invertebrate sequence entries, part 1765.
3330. gbinv1766.seq - Invertebrate sequence entries, part 1766.
3331. gbinv1767.seq - Invertebrate sequence entries, part 1767.
3332. gbinv1768.seq - Invertebrate sequence entries, part 1768.
3333. gbinv1769.seq - Invertebrate sequence entries, part 1769.
3334. gbinv177.seq - Invertebrate sequence entries, part 177.
3335. gbinv1770.seq - Invertebrate sequence entries, part 1770.
3336. gbinv1771.seq - Invertebrate sequence entries, part 1771.
3337. gbinv1772.seq - Invertebrate sequence entries, part 1772.
3338. gbinv1773.seq - Invertebrate sequence entries, part 1773.
3339. gbinv1774.seq - Invertebrate sequence entries, part 1774.
3340. gbinv1775.seq - Invertebrate sequence entries, part 1775.
3341. gbinv1776.seq - Invertebrate sequence entries, part 1776.
3342. gbinv1777.seq - Invertebrate sequence entries, part 1777.
3343. gbinv1778.seq - Invertebrate sequence entries, part 1778.
3344. gbinv1779.seq - Invertebrate sequence entries, part 1779.
3345. gbinv178.seq - Invertebrate sequence entries, part 178.
3346. gbinv1780.seq - Invertebrate sequence entries, part 1780.
3347. gbinv1781.seq - Invertebrate sequence entries, part 1781.
3348. gbinv1782.seq - Invertebrate sequence entries, part 1782.
3349. gbinv1783.seq - Invertebrate sequence entries, part 1783.
3350. gbinv1784.seq - Invertebrate sequence entries, part 1784.
3351. gbinv1785.seq - Invertebrate sequence entries, part 1785.
3352. gbinv1786.seq - Invertebrate sequence entries, part 1786.
3353. gbinv1787.seq - Invertebrate sequence entries, part 1787.
3354. gbinv1788.seq - Invertebrate sequence entries, part 1788.
3355. gbinv1789.seq - Invertebrate sequence entries, part 1789.
3356. gbinv179.seq - Invertebrate sequence entries, part 179.
3357. gbinv1790.seq - Invertebrate sequence entries, part 1790.
3358. gbinv1791.seq - Invertebrate sequence entries, part 1791.
3359. gbinv1792.seq - Invertebrate sequence entries, part 1792.
3360. gbinv1793.seq - Invertebrate sequence entries, part 1793.
3361. gbinv1794.seq - Invertebrate sequence entries, part 1794.
3362. gbinv1795.seq - Invertebrate sequence entries, part 1795.
3363. gbinv1796.seq - Invertebrate sequence entries, part 1796.
3364. gbinv1797.seq - Invertebrate sequence entries, part 1797.
3365. gbinv1798.seq - Invertebrate sequence entries, part 1798.
3366. gbinv1799.seq - Invertebrate sequence entries, part 1799.
3367. gbinv18.seq - Invertebrate sequence entries, part 18.
3368. gbinv180.seq - Invertebrate sequence entries, part 180.
3369. gbinv1800.seq - Invertebrate sequence entries, part 1800.
3370. gbinv1801.seq - Invertebrate sequence entries, part 1801.
3371. gbinv1802.seq - Invertebrate sequence entries, part 1802.
3372. gbinv1803.seq - Invertebrate sequence entries, part 1803.
3373. gbinv1804.seq - Invertebrate sequence entries, part 1804.
3374. gbinv1805.seq - Invertebrate sequence entries, part 1805.
3375. gbinv1806.seq - Invertebrate sequence entries, part 1806.
3376. gbinv1807.seq - Invertebrate sequence entries, part 1807.
3377. gbinv1808.seq - Invertebrate sequence entries, part 1808.
3378. gbinv1809.seq - Invertebrate sequence entries, part 1809.
3379. gbinv181.seq - Invertebrate sequence entries, part 181.
3380. gbinv1810.seq - Invertebrate sequence entries, part 1810.
3381. gbinv1811.seq - Invertebrate sequence entries, part 1811.
3382. gbinv1812.seq - Invertebrate sequence entries, part 1812.
3383. gbinv1813.seq - Invertebrate sequence entries, part 1813.
3384. gbinv1814.seq - Invertebrate sequence entries, part 1814.
3385. gbinv1815.seq - Invertebrate sequence entries, part 1815.
3386. gbinv1816.seq - Invertebrate sequence entries, part 1816.
3387. gbinv1817.seq - Invertebrate sequence entries, part 1817.
3388. gbinv1818.seq - Invertebrate sequence entries, part 1818.
3389. gbinv1819.seq - Invertebrate sequence entries, part 1819.
3390. gbinv182.seq - Invertebrate sequence entries, part 182.
3391. gbinv1820.seq - Invertebrate sequence entries, part 1820.
3392. gbinv1821.seq - Invertebrate sequence entries, part 1821.
3393. gbinv1822.seq - Invertebrate sequence entries, part 1822.
3394. gbinv1823.seq - Invertebrate sequence entries, part 1823.
3395. gbinv1824.seq - Invertebrate sequence entries, part 1824.
3396. gbinv1825.seq - Invertebrate sequence entries, part 1825.
3397. gbinv1826.seq - Invertebrate sequence entries, part 1826.
3398. gbinv1827.seq - Invertebrate sequence entries, part 1827.
3399. gbinv1828.seq - Invertebrate sequence entries, part 1828.
3400. gbinv1829.seq - Invertebrate sequence entries, part 1829.
3401. gbinv183.seq - Invertebrate sequence entries, part 183.
3402. gbinv1830.seq - Invertebrate sequence entries, part 1830.
3403. gbinv1831.seq - Invertebrate sequence entries, part 1831.
3404. gbinv1832.seq - Invertebrate sequence entries, part 1832.
3405. gbinv1833.seq - Invertebrate sequence entries, part 1833.
3406. gbinv1834.seq - Invertebrate sequence entries, part 1834.
3407. gbinv1835.seq - Invertebrate sequence entries, part 1835.
3408. gbinv1836.seq - Invertebrate sequence entries, part 1836.
3409. gbinv1837.seq - Invertebrate sequence entries, part 1837.
3410. gbinv1838.seq - Invertebrate sequence entries, part 1838.
3411. gbinv1839.seq - Invertebrate sequence entries, part 1839.
3412. gbinv184.seq - Invertebrate sequence entries, part 184.
3413. gbinv1840.seq - Invertebrate sequence entries, part 1840.
3414. gbinv1841.seq - Invertebrate sequence entries, part 1841.
3415. gbinv1842.seq - Invertebrate sequence entries, part 1842.
3416. gbinv1843.seq - Invertebrate sequence entries, part 1843.
3417. gbinv1844.seq - Invertebrate sequence entries, part 1844.
3418. gbinv1845.seq - Invertebrate sequence entries, part 1845.
3419. gbinv1846.seq - Invertebrate sequence entries, part 1846.
3420. gbinv1847.seq - Invertebrate sequence entries, part 1847.
3421. gbinv1848.seq - Invertebrate sequence entries, part 1848.
3422. gbinv1849.seq - Invertebrate sequence entries, part 1849.
3423. gbinv185.seq - Invertebrate sequence entries, part 185.
3424. gbinv1850.seq - Invertebrate sequence entries, part 1850.
3425. gbinv1851.seq - Invertebrate sequence entries, part 1851.
3426. gbinv1852.seq - Invertebrate sequence entries, part 1852.
3427. gbinv1853.seq - Invertebrate sequence entries, part 1853.
3428. gbinv1854.seq - Invertebrate sequence entries, part 1854.
3429. gbinv1855.seq - Invertebrate sequence entries, part 1855.
3430. gbinv1856.seq - Invertebrate sequence entries, part 1856.
3431. gbinv1857.seq - Invertebrate sequence entries, part 1857.
3432. gbinv1858.seq - Invertebrate sequence entries, part 1858.
3433. gbinv1859.seq - Invertebrate sequence entries, part 1859.
3434. gbinv186.seq - Invertebrate sequence entries, part 186.
3435. gbinv1860.seq - Invertebrate sequence entries, part 1860.
3436. gbinv1861.seq - Invertebrate sequence entries, part 1861.
3437. gbinv1862.seq - Invertebrate sequence entries, part 1862.
3438. gbinv1863.seq - Invertebrate sequence entries, part 1863.
3439. gbinv1864.seq - Invertebrate sequence entries, part 1864.
3440. gbinv1865.seq - Invertebrate sequence entries, part 1865.
3441. gbinv1866.seq - Invertebrate sequence entries, part 1866.
3442. gbinv1867.seq - Invertebrate sequence entries, part 1867.
3443. gbinv1868.seq - Invertebrate sequence entries, part 1868.
3444. gbinv1869.seq - Invertebrate sequence entries, part 1869.
3445. gbinv187.seq - Invertebrate sequence entries, part 187.
3446. gbinv1870.seq - Invertebrate sequence entries, part 1870.
3447. gbinv1871.seq - Invertebrate sequence entries, part 1871.
3448. gbinv1872.seq - Invertebrate sequence entries, part 1872.
3449. gbinv1873.seq - Invertebrate sequence entries, part 1873.
3450. gbinv1874.seq - Invertebrate sequence entries, part 1874.
3451. gbinv1875.seq - Invertebrate sequence entries, part 1875.
3452. gbinv1876.seq - Invertebrate sequence entries, part 1876.
3453. gbinv1877.seq - Invertebrate sequence entries, part 1877.
3454. gbinv1878.seq - Invertebrate sequence entries, part 1878.
3455. gbinv1879.seq - Invertebrate sequence entries, part 1879.
3456. gbinv188.seq - Invertebrate sequence entries, part 188.
3457. gbinv1880.seq - Invertebrate sequence entries, part 1880.
3458. gbinv1881.seq - Invertebrate sequence entries, part 1881.
3459. gbinv1882.seq - Invertebrate sequence entries, part 1882.
3460. gbinv1883.seq - Invertebrate sequence entries, part 1883.
3461. gbinv1884.seq - Invertebrate sequence entries, part 1884.
3462. gbinv1885.seq - Invertebrate sequence entries, part 1885.
3463. gbinv1886.seq - Invertebrate sequence entries, part 1886.
3464. gbinv1887.seq - Invertebrate sequence entries, part 1887.
3465. gbinv1888.seq - Invertebrate sequence entries, part 1888.
3466. gbinv1889.seq - Invertebrate sequence entries, part 1889.
3467. gbinv189.seq - Invertebrate sequence entries, part 189.
3468. gbinv1890.seq - Invertebrate sequence entries, part 1890.
3469. gbinv1891.seq - Invertebrate sequence entries, part 1891.
3470. gbinv1892.seq - Invertebrate sequence entries, part 1892.
3471. gbinv1893.seq - Invertebrate sequence entries, part 1893.
3472. gbinv1894.seq - Invertebrate sequence entries, part 1894.
3473. gbinv1895.seq - Invertebrate sequence entries, part 1895.
3474. gbinv1896.seq - Invertebrate sequence entries, part 1896.
3475. gbinv1897.seq - Invertebrate sequence entries, part 1897.
3476. gbinv1898.seq - Invertebrate sequence entries, part 1898.
3477. gbinv1899.seq - Invertebrate sequence entries, part 1899.
3478. gbinv19.seq - Invertebrate sequence entries, part 19.
3479. gbinv190.seq - Invertebrate sequence entries, part 190.
3480. gbinv1900.seq - Invertebrate sequence entries, part 1900.
3481. gbinv1901.seq - Invertebrate sequence entries, part 1901.
3482. gbinv1902.seq - Invertebrate sequence entries, part 1902.
3483. gbinv1903.seq - Invertebrate sequence entries, part 1903.
3484. gbinv1904.seq - Invertebrate sequence entries, part 1904.
3485. gbinv1905.seq - Invertebrate sequence entries, part 1905.
3486. gbinv1906.seq - Invertebrate sequence entries, part 1906.
3487. gbinv1907.seq - Invertebrate sequence entries, part 1907.
3488. gbinv1908.seq - Invertebrate sequence entries, part 1908.
3489. gbinv1909.seq - Invertebrate sequence entries, part 1909.
3490. gbinv191.seq - Invertebrate sequence entries, part 191.
3491. gbinv1910.seq - Invertebrate sequence entries, part 1910.
3492. gbinv1911.seq - Invertebrate sequence entries, part 1911.
3493. gbinv1912.seq - Invertebrate sequence entries, part 1912.
3494. gbinv1913.seq - Invertebrate sequence entries, part 1913.
3495. gbinv1914.seq - Invertebrate sequence entries, part 1914.
3496. gbinv1915.seq - Invertebrate sequence entries, part 1915.
3497. gbinv1916.seq - Invertebrate sequence entries, part 1916.
3498. gbinv1917.seq - Invertebrate sequence entries, part 1917.
3499. gbinv1918.seq - Invertebrate sequence entries, part 1918.
3500. gbinv1919.seq - Invertebrate sequence entries, part 1919.
3501. gbinv192.seq - Invertebrate sequence entries, part 192.
3502. gbinv1920.seq - Invertebrate sequence entries, part 1920.
3503. gbinv1921.seq - Invertebrate sequence entries, part 1921.
3504. gbinv1922.seq - Invertebrate sequence entries, part 1922.
3505. gbinv1923.seq - Invertebrate sequence entries, part 1923.
3506. gbinv1924.seq - Invertebrate sequence entries, part 1924.
3507. gbinv1925.seq - Invertebrate sequence entries, part 1925.
3508. gbinv1926.seq - Invertebrate sequence entries, part 1926.
3509. gbinv1927.seq - Invertebrate sequence entries, part 1927.
3510. gbinv1928.seq - Invertebrate sequence entries, part 1928.
3511. gbinv1929.seq - Invertebrate sequence entries, part 1929.
3512. gbinv193.seq - Invertebrate sequence entries, part 193.
3513. gbinv1930.seq - Invertebrate sequence entries, part 1930.
3514. gbinv1931.seq - Invertebrate sequence entries, part 1931.
3515. gbinv1932.seq - Invertebrate sequence entries, part 1932.
3516. gbinv1933.seq - Invertebrate sequence entries, part 1933.
3517. gbinv1934.seq - Invertebrate sequence entries, part 1934.
3518. gbinv1935.seq - Invertebrate sequence entries, part 1935.
3519. gbinv1936.seq - Invertebrate sequence entries, part 1936.
3520. gbinv1937.seq - Invertebrate sequence entries, part 1937.
3521. gbinv1938.seq - Invertebrate sequence entries, part 1938.
3522. gbinv1939.seq - Invertebrate sequence entries, part 1939.
3523. gbinv194.seq - Invertebrate sequence entries, part 194.
3524. gbinv1940.seq - Invertebrate sequence entries, part 1940.
3525. gbinv1941.seq - Invertebrate sequence entries, part 1941.
3526. gbinv1942.seq - Invertebrate sequence entries, part 1942.
3527. gbinv1943.seq - Invertebrate sequence entries, part 1943.
3528. gbinv1944.seq - Invertebrate sequence entries, part 1944.
3529. gbinv1945.seq - Invertebrate sequence entries, part 1945.
3530. gbinv1946.seq - Invertebrate sequence entries, part 1946.
3531. gbinv1947.seq - Invertebrate sequence entries, part 1947.
3532. gbinv1948.seq - Invertebrate sequence entries, part 1948.
3533. gbinv1949.seq - Invertebrate sequence entries, part 1949.
3534. gbinv195.seq - Invertebrate sequence entries, part 195.
3535. gbinv1950.seq - Invertebrate sequence entries, part 1950.
3536. gbinv1951.seq - Invertebrate sequence entries, part 1951.
3537. gbinv1952.seq - Invertebrate sequence entries, part 1952.
3538. gbinv1953.seq - Invertebrate sequence entries, part 1953.
3539. gbinv1954.seq - Invertebrate sequence entries, part 1954.
3540. gbinv1955.seq - Invertebrate sequence entries, part 1955.
3541. gbinv1956.seq - Invertebrate sequence entries, part 1956.
3542. gbinv1957.seq - Invertebrate sequence entries, part 1957.
3543. gbinv1958.seq - Invertebrate sequence entries, part 1958.
3544. gbinv1959.seq - Invertebrate sequence entries, part 1959.
3545. gbinv196.seq - Invertebrate sequence entries, part 196.
3546. gbinv1960.seq - Invertebrate sequence entries, part 1960.
3547. gbinv1961.seq - Invertebrate sequence entries, part 1961.
3548. gbinv1962.seq - Invertebrate sequence entries, part 1962.
3549. gbinv1963.seq - Invertebrate sequence entries, part 1963.
3550. gbinv1964.seq - Invertebrate sequence entries, part 1964.
3551. gbinv1965.seq - Invertebrate sequence entries, part 1965.
3552. gbinv1966.seq - Invertebrate sequence entries, part 1966.
3553. gbinv1967.seq - Invertebrate sequence entries, part 1967.
3554. gbinv1968.seq - Invertebrate sequence entries, part 1968.
3555. gbinv1969.seq - Invertebrate sequence entries, part 1969.
3556. gbinv197.seq - Invertebrate sequence entries, part 197.
3557. gbinv1970.seq - Invertebrate sequence entries, part 1970.
3558. gbinv1971.seq - Invertebrate sequence entries, part 1971.
3559. gbinv1972.seq - Invertebrate sequence entries, part 1972.
3560. gbinv1973.seq - Invertebrate sequence entries, part 1973.
3561. gbinv1974.seq - Invertebrate sequence entries, part 1974.
3562. gbinv1975.seq - Invertebrate sequence entries, part 1975.
3563. gbinv1976.seq - Invertebrate sequence entries, part 1976.
3564. gbinv1977.seq - Invertebrate sequence entries, part 1977.
3565. gbinv1978.seq - Invertebrate sequence entries, part 1978.
3566. gbinv1979.seq - Invertebrate sequence entries, part 1979.
3567. gbinv198.seq - Invertebrate sequence entries, part 198.
3568. gbinv1980.seq - Invertebrate sequence entries, part 1980.
3569. gbinv1981.seq - Invertebrate sequence entries, part 1981.
3570. gbinv1982.seq - Invertebrate sequence entries, part 1982.
3571. gbinv1983.seq - Invertebrate sequence entries, part 1983.
3572. gbinv1984.seq - Invertebrate sequence entries, part 1984.
3573. gbinv1985.seq - Invertebrate sequence entries, part 1985.
3574. gbinv1986.seq - Invertebrate sequence entries, part 1986.
3575. gbinv1987.seq - Invertebrate sequence entries, part 1987.
3576. gbinv1988.seq - Invertebrate sequence entries, part 1988.
3577. gbinv1989.seq - Invertebrate sequence entries, part 1989.
3578. gbinv199.seq - Invertebrate sequence entries, part 199.
3579. gbinv1990.seq - Invertebrate sequence entries, part 1990.
3580. gbinv1991.seq - Invertebrate sequence entries, part 1991.
3581. gbinv1992.seq - Invertebrate sequence entries, part 1992.
3582. gbinv1993.seq - Invertebrate sequence entries, part 1993.
3583. gbinv1994.seq - Invertebrate sequence entries, part 1994.
3584. gbinv1995.seq - Invertebrate sequence entries, part 1995.
3585. gbinv1996.seq - Invertebrate sequence entries, part 1996.
3586. gbinv1997.seq - Invertebrate sequence entries, part 1997.
3587. gbinv1998.seq - Invertebrate sequence entries, part 1998.
3588. gbinv1999.seq - Invertebrate sequence entries, part 1999.
3589. gbinv2.seq - Invertebrate sequence entries, part 2.
3590. gbinv20.seq - Invertebrate sequence entries, part 20.
3591. gbinv200.seq - Invertebrate sequence entries, part 200.
3592. gbinv2000.seq - Invertebrate sequence entries, part 2000.
3593. gbinv2001.seq - Invertebrate sequence entries, part 2001.
3594. gbinv2002.seq - Invertebrate sequence entries, part 2002.
3595. gbinv2003.seq - Invertebrate sequence entries, part 2003.
3596. gbinv2004.seq - Invertebrate sequence entries, part 2004.
3597. gbinv2005.seq - Invertebrate sequence entries, part 2005.
3598. gbinv2006.seq - Invertebrate sequence entries, part 2006.
3599. gbinv2007.seq - Invertebrate sequence entries, part 2007.
3600. gbinv2008.seq - Invertebrate sequence entries, part 2008.
3601. gbinv2009.seq - Invertebrate sequence entries, part 2009.
3602. gbinv201.seq - Invertebrate sequence entries, part 201.
3603. gbinv2010.seq - Invertebrate sequence entries, part 2010.
3604. gbinv2011.seq - Invertebrate sequence entries, part 2011.
3605. gbinv2012.seq - Invertebrate sequence entries, part 2012.
3606. gbinv2013.seq - Invertebrate sequence entries, part 2013.
3607. gbinv2014.seq - Invertebrate sequence entries, part 2014.
3608. gbinv2015.seq - Invertebrate sequence entries, part 2015.
3609. gbinv2016.seq - Invertebrate sequence entries, part 2016.
3610. gbinv2017.seq - Invertebrate sequence entries, part 2017.
3611. gbinv2018.seq - Invertebrate sequence entries, part 2018.
3612. gbinv2019.seq - Invertebrate sequence entries, part 2019.
3613. gbinv202.seq - Invertebrate sequence entries, part 202.
3614. gbinv2020.seq - Invertebrate sequence entries, part 2020.
3615. gbinv2021.seq - Invertebrate sequence entries, part 2021.
3616. gbinv2022.seq - Invertebrate sequence entries, part 2022.
3617. gbinv2023.seq - Invertebrate sequence entries, part 2023.
3618. gbinv2024.seq - Invertebrate sequence entries, part 2024.
3619. gbinv2025.seq - Invertebrate sequence entries, part 2025.
3620. gbinv2026.seq - Invertebrate sequence entries, part 2026.
3621. gbinv2027.seq - Invertebrate sequence entries, part 2027.
3622. gbinv2028.seq - Invertebrate sequence entries, part 2028.
3623. gbinv2029.seq - Invertebrate sequence entries, part 2029.
3624. gbinv203.seq - Invertebrate sequence entries, part 203.
3625. gbinv2030.seq - Invertebrate sequence entries, part 2030.
3626. gbinv2031.seq - Invertebrate sequence entries, part 2031.
3627. gbinv2032.seq - Invertebrate sequence entries, part 2032.
3628. gbinv2033.seq - Invertebrate sequence entries, part 2033.
3629. gbinv2034.seq - Invertebrate sequence entries, part 2034.
3630. gbinv2035.seq - Invertebrate sequence entries, part 2035.
3631. gbinv2036.seq - Invertebrate sequence entries, part 2036.
3632. gbinv2037.seq - Invertebrate sequence entries, part 2037.
3633. gbinv2038.seq - Invertebrate sequence entries, part 2038.
3634. gbinv2039.seq - Invertebrate sequence entries, part 2039.
3635. gbinv204.seq - Invertebrate sequence entries, part 204.
3636. gbinv2040.seq - Invertebrate sequence entries, part 2040.
3637. gbinv2041.seq - Invertebrate sequence entries, part 2041.
3638. gbinv2042.seq - Invertebrate sequence entries, part 2042.
3639. gbinv2043.seq - Invertebrate sequence entries, part 2043.
3640. gbinv2044.seq - Invertebrate sequence entries, part 2044.
3641. gbinv2045.seq - Invertebrate sequence entries, part 2045.
3642. gbinv2046.seq - Invertebrate sequence entries, part 2046.
3643. gbinv2047.seq - Invertebrate sequence entries, part 2047.
3644. gbinv2048.seq - Invertebrate sequence entries, part 2048.
3645. gbinv2049.seq - Invertebrate sequence entries, part 2049.
3646. gbinv205.seq - Invertebrate sequence entries, part 205.
3647. gbinv2050.seq - Invertebrate sequence entries, part 2050.
3648. gbinv2051.seq - Invertebrate sequence entries, part 2051.
3649. gbinv2052.seq - Invertebrate sequence entries, part 2052.
3650. gbinv2053.seq - Invertebrate sequence entries, part 2053.
3651. gbinv2054.seq - Invertebrate sequence entries, part 2054.
3652. gbinv2055.seq - Invertebrate sequence entries, part 2055.
3653. gbinv2056.seq - Invertebrate sequence entries, part 2056.
3654. gbinv2057.seq - Invertebrate sequence entries, part 2057.
3655. gbinv2058.seq - Invertebrate sequence entries, part 2058.
3656. gbinv2059.seq - Invertebrate sequence entries, part 2059.
3657. gbinv206.seq - Invertebrate sequence entries, part 206.
3658. gbinv2060.seq - Invertebrate sequence entries, part 2060.
3659. gbinv2061.seq - Invertebrate sequence entries, part 2061.
3660. gbinv2062.seq - Invertebrate sequence entries, part 2062.
3661. gbinv2063.seq - Invertebrate sequence entries, part 2063.
3662. gbinv2064.seq - Invertebrate sequence entries, part 2064.
3663. gbinv2065.seq - Invertebrate sequence entries, part 2065.
3664. gbinv2066.seq - Invertebrate sequence entries, part 2066.
3665. gbinv2067.seq - Invertebrate sequence entries, part 2067.
3666. gbinv2068.seq - Invertebrate sequence entries, part 2068.
3667. gbinv2069.seq - Invertebrate sequence entries, part 2069.
3668. gbinv207.seq - Invertebrate sequence entries, part 207.
3669. gbinv2070.seq - Invertebrate sequence entries, part 2070.
3670. gbinv2071.seq - Invertebrate sequence entries, part 2071.
3671. gbinv2072.seq - Invertebrate sequence entries, part 2072.
3672. gbinv2073.seq - Invertebrate sequence entries, part 2073.
3673. gbinv2074.seq - Invertebrate sequence entries, part 2074.
3674. gbinv2075.seq - Invertebrate sequence entries, part 2075.
3675. gbinv2076.seq - Invertebrate sequence entries, part 2076.
3676. gbinv2077.seq - Invertebrate sequence entries, part 2077.
3677. gbinv2078.seq - Invertebrate sequence entries, part 2078.
3678. gbinv2079.seq - Invertebrate sequence entries, part 2079.
3679. gbinv208.seq - Invertebrate sequence entries, part 208.
3680. gbinv2080.seq - Invertebrate sequence entries, part 2080.
3681. gbinv2081.seq - Invertebrate sequence entries, part 2081.
3682. gbinv2082.seq - Invertebrate sequence entries, part 2082.
3683. gbinv2083.seq - Invertebrate sequence entries, part 2083.
3684. gbinv2084.seq - Invertebrate sequence entries, part 2084.
3685. gbinv2085.seq - Invertebrate sequence entries, part 2085.
3686. gbinv2086.seq - Invertebrate sequence entries, part 2086.
3687. gbinv2087.seq - Invertebrate sequence entries, part 2087.
3688. gbinv2088.seq - Invertebrate sequence entries, part 2088.
3689. gbinv2089.seq - Invertebrate sequence entries, part 2089.
3690. gbinv209.seq - Invertebrate sequence entries, part 209.
3691. gbinv2090.seq - Invertebrate sequence entries, part 2090.
3692. gbinv2091.seq - Invertebrate sequence entries, part 2091.
3693. gbinv2092.seq - Invertebrate sequence entries, part 2092.
3694. gbinv2093.seq - Invertebrate sequence entries, part 2093.
3695. gbinv2094.seq - Invertebrate sequence entries, part 2094.
3696. gbinv2095.seq - Invertebrate sequence entries, part 2095.
3697. gbinv2096.seq - Invertebrate sequence entries, part 2096.
3698. gbinv2097.seq - Invertebrate sequence entries, part 2097.
3699. gbinv2098.seq - Invertebrate sequence entries, part 2098.
3700. gbinv2099.seq - Invertebrate sequence entries, part 2099.
3701. gbinv21.seq - Invertebrate sequence entries, part 21.
3702. gbinv210.seq - Invertebrate sequence entries, part 210.
3703. gbinv2100.seq - Invertebrate sequence entries, part 2100.
3704. gbinv2101.seq - Invertebrate sequence entries, part 2101.
3705. gbinv2102.seq - Invertebrate sequence entries, part 2102.
3706. gbinv2103.seq - Invertebrate sequence entries, part 2103.
3707. gbinv2104.seq - Invertebrate sequence entries, part 2104.
3708. gbinv2105.seq - Invertebrate sequence entries, part 2105.
3709. gbinv2106.seq - Invertebrate sequence entries, part 2106.
3710. gbinv2107.seq - Invertebrate sequence entries, part 2107.
3711. gbinv2108.seq - Invertebrate sequence entries, part 2108.
3712. gbinv2109.seq - Invertebrate sequence entries, part 2109.
3713. gbinv211.seq - Invertebrate sequence entries, part 211.
3714. gbinv2110.seq - Invertebrate sequence entries, part 2110.
3715. gbinv2111.seq - Invertebrate sequence entries, part 2111.
3716. gbinv2112.seq - Invertebrate sequence entries, part 2112.
3717. gbinv2113.seq - Invertebrate sequence entries, part 2113.
3718. gbinv2114.seq - Invertebrate sequence entries, part 2114.
3719. gbinv2115.seq - Invertebrate sequence entries, part 2115.
3720. gbinv2116.seq - Invertebrate sequence entries, part 2116.
3721. gbinv2117.seq - Invertebrate sequence entries, part 2117.
3722. gbinv2118.seq - Invertebrate sequence entries, part 2118.
3723. gbinv2119.seq - Invertebrate sequence entries, part 2119.
3724. gbinv212.seq - Invertebrate sequence entries, part 212.
3725. gbinv2120.seq - Invertebrate sequence entries, part 2120.
3726. gbinv2121.seq - Invertebrate sequence entries, part 2121.
3727. gbinv2122.seq - Invertebrate sequence entries, part 2122.
3728. gbinv2123.seq - Invertebrate sequence entries, part 2123.
3729. gbinv2124.seq - Invertebrate sequence entries, part 2124.
3730. gbinv2125.seq - Invertebrate sequence entries, part 2125.
3731. gbinv2126.seq - Invertebrate sequence entries, part 2126.
3732. gbinv2127.seq - Invertebrate sequence entries, part 2127.
3733. gbinv2128.seq - Invertebrate sequence entries, part 2128.
3734. gbinv2129.seq - Invertebrate sequence entries, part 2129.
3735. gbinv213.seq - Invertebrate sequence entries, part 213.
3736. gbinv2130.seq - Invertebrate sequence entries, part 2130.
3737. gbinv2131.seq - Invertebrate sequence entries, part 2131.
3738. gbinv2132.seq - Invertebrate sequence entries, part 2132.
3739. gbinv2133.seq - Invertebrate sequence entries, part 2133.
3740. gbinv2134.seq - Invertebrate sequence entries, part 2134.
3741. gbinv2135.seq - Invertebrate sequence entries, part 2135.
3742. gbinv2136.seq - Invertebrate sequence entries, part 2136.
3743. gbinv2137.seq - Invertebrate sequence entries, part 2137.
3744. gbinv2138.seq - Invertebrate sequence entries, part 2138.
3745. gbinv2139.seq - Invertebrate sequence entries, part 2139.
3746. gbinv214.seq - Invertebrate sequence entries, part 214.
3747. gbinv2140.seq - Invertebrate sequence entries, part 2140.
3748. gbinv2141.seq - Invertebrate sequence entries, part 2141.
3749. gbinv2142.seq - Invertebrate sequence entries, part 2142.
3750. gbinv2143.seq - Invertebrate sequence entries, part 2143.
3751. gbinv2144.seq - Invertebrate sequence entries, part 2144.
3752. gbinv2145.seq - Invertebrate sequence entries, part 2145.
3753. gbinv2146.seq - Invertebrate sequence entries, part 2146.
3754. gbinv2147.seq - Invertebrate sequence entries, part 2147.
3755. gbinv2148.seq - Invertebrate sequence entries, part 2148.
3756. gbinv2149.seq - Invertebrate sequence entries, part 2149.
3757. gbinv215.seq - Invertebrate sequence entries, part 215.
3758. gbinv2150.seq - Invertebrate sequence entries, part 2150.
3759. gbinv2151.seq - Invertebrate sequence entries, part 2151.
3760. gbinv2152.seq - Invertebrate sequence entries, part 2152.
3761. gbinv2153.seq - Invertebrate sequence entries, part 2153.
3762. gbinv2154.seq - Invertebrate sequence entries, part 2154.
3763. gbinv2155.seq - Invertebrate sequence entries, part 2155.
3764. gbinv2156.seq - Invertebrate sequence entries, part 2156.
3765. gbinv2157.seq - Invertebrate sequence entries, part 2157.
3766. gbinv2158.seq - Invertebrate sequence entries, part 2158.
3767. gbinv2159.seq - Invertebrate sequence entries, part 2159.
3768. gbinv216.seq - Invertebrate sequence entries, part 216.
3769. gbinv2160.seq - Invertebrate sequence entries, part 2160.
3770. gbinv2161.seq - Invertebrate sequence entries, part 2161.
3771. gbinv2162.seq - Invertebrate sequence entries, part 2162.
3772. gbinv2163.seq - Invertebrate sequence entries, part 2163.
3773. gbinv2164.seq - Invertebrate sequence entries, part 2164.
3774. gbinv2165.seq - Invertebrate sequence entries, part 2165.
3775. gbinv2166.seq - Invertebrate sequence entries, part 2166.
3776. gbinv2167.seq - Invertebrate sequence entries, part 2167.
3777. gbinv2168.seq - Invertebrate sequence entries, part 2168.
3778. gbinv2169.seq - Invertebrate sequence entries, part 2169.
3779. gbinv217.seq - Invertebrate sequence entries, part 217.
3780. gbinv2170.seq - Invertebrate sequence entries, part 2170.
3781. gbinv2171.seq - Invertebrate sequence entries, part 2171.
3782. gbinv2172.seq - Invertebrate sequence entries, part 2172.
3783. gbinv2173.seq - Invertebrate sequence entries, part 2173.
3784. gbinv2174.seq - Invertebrate sequence entries, part 2174.
3785. gbinv2175.seq - Invertebrate sequence entries, part 2175.
3786. gbinv2176.seq - Invertebrate sequence entries, part 2176.
3787. gbinv2177.seq - Invertebrate sequence entries, part 2177.
3788. gbinv2178.seq - Invertebrate sequence entries, part 2178.
3789. gbinv2179.seq - Invertebrate sequence entries, part 2179.
3790. gbinv218.seq - Invertebrate sequence entries, part 218.
3791. gbinv2180.seq - Invertebrate sequence entries, part 2180.
3792. gbinv2181.seq - Invertebrate sequence entries, part 2181.
3793. gbinv2182.seq - Invertebrate sequence entries, part 2182.
3794. gbinv2183.seq - Invertebrate sequence entries, part 2183.
3795. gbinv2184.seq - Invertebrate sequence entries, part 2184.
3796. gbinv2185.seq - Invertebrate sequence entries, part 2185.
3797. gbinv2186.seq - Invertebrate sequence entries, part 2186.
3798. gbinv2187.seq - Invertebrate sequence entries, part 2187.
3799. gbinv2188.seq - Invertebrate sequence entries, part 2188.
3800. gbinv2189.seq - Invertebrate sequence entries, part 2189.
3801. gbinv219.seq - Invertebrate sequence entries, part 219.
3802. gbinv2190.seq - Invertebrate sequence entries, part 2190.
3803. gbinv2191.seq - Invertebrate sequence entries, part 2191.
3804. gbinv2192.seq - Invertebrate sequence entries, part 2192.
3805. gbinv2193.seq - Invertebrate sequence entries, part 2193.
3806. gbinv2194.seq - Invertebrate sequence entries, part 2194.
3807. gbinv2195.seq - Invertebrate sequence entries, part 2195.
3808. gbinv2196.seq - Invertebrate sequence entries, part 2196.
3809. gbinv2197.seq - Invertebrate sequence entries, part 2197.
3810. gbinv2198.seq - Invertebrate sequence entries, part 2198.
3811. gbinv2199.seq - Invertebrate sequence entries, part 2199.
3812. gbinv22.seq - Invertebrate sequence entries, part 22.
3813. gbinv220.seq - Invertebrate sequence entries, part 220.
3814. gbinv2200.seq - Invertebrate sequence entries, part 2200.
3815. gbinv2201.seq - Invertebrate sequence entries, part 2201.
3816. gbinv2202.seq - Invertebrate sequence entries, part 2202.
3817. gbinv2203.seq - Invertebrate sequence entries, part 2203.
3818. gbinv2204.seq - Invertebrate sequence entries, part 2204.
3819. gbinv2205.seq - Invertebrate sequence entries, part 2205.
3820. gbinv2206.seq - Invertebrate sequence entries, part 2206.
3821. gbinv2207.seq - Invertebrate sequence entries, part 2207.
3822. gbinv2208.seq - Invertebrate sequence entries, part 2208.
3823. gbinv2209.seq - Invertebrate sequence entries, part 2209.
3824. gbinv221.seq - Invertebrate sequence entries, part 221.
3825. gbinv2210.seq - Invertebrate sequence entries, part 2210.
3826. gbinv2211.seq - Invertebrate sequence entries, part 2211.
3827. gbinv2212.seq - Invertebrate sequence entries, part 2212.
3828. gbinv2213.seq - Invertebrate sequence entries, part 2213.
3829. gbinv2214.seq - Invertebrate sequence entries, part 2214.
3830. gbinv2215.seq - Invertebrate sequence entries, part 2215.
3831. gbinv2216.seq - Invertebrate sequence entries, part 2216.
3832. gbinv2217.seq - Invertebrate sequence entries, part 2217.
3833. gbinv2218.seq - Invertebrate sequence entries, part 2218.
3834. gbinv2219.seq - Invertebrate sequence entries, part 2219.
3835. gbinv222.seq - Invertebrate sequence entries, part 222.
3836. gbinv2220.seq - Invertebrate sequence entries, part 2220.
3837. gbinv2221.seq - Invertebrate sequence entries, part 2221.
3838. gbinv2222.seq - Invertebrate sequence entries, part 2222.
3839. gbinv2223.seq - Invertebrate sequence entries, part 2223.
3840. gbinv2224.seq - Invertebrate sequence entries, part 2224.
3841. gbinv2225.seq - Invertebrate sequence entries, part 2225.
3842. gbinv2226.seq - Invertebrate sequence entries, part 2226.
3843. gbinv2227.seq - Invertebrate sequence entries, part 2227.
3844. gbinv2228.seq - Invertebrate sequence entries, part 2228.
3845. gbinv2229.seq - Invertebrate sequence entries, part 2229.
3846. gbinv223.seq - Invertebrate sequence entries, part 223.
3847. gbinv2230.seq - Invertebrate sequence entries, part 2230.
3848. gbinv2231.seq - Invertebrate sequence entries, part 2231.
3849. gbinv2232.seq - Invertebrate sequence entries, part 2232.
3850. gbinv2233.seq - Invertebrate sequence entries, part 2233.
3851. gbinv2234.seq - Invertebrate sequence entries, part 2234.
3852. gbinv2235.seq - Invertebrate sequence entries, part 2235.
3853. gbinv2236.seq - Invertebrate sequence entries, part 2236.
3854. gbinv2237.seq - Invertebrate sequence entries, part 2237.
3855. gbinv2238.seq - Invertebrate sequence entries, part 2238.
3856. gbinv2239.seq - Invertebrate sequence entries, part 2239.
3857. gbinv224.seq - Invertebrate sequence entries, part 224.
3858. gbinv2240.seq - Invertebrate sequence entries, part 2240.
3859. gbinv2241.seq - Invertebrate sequence entries, part 2241.
3860. gbinv2242.seq - Invertebrate sequence entries, part 2242.
3861. gbinv2243.seq - Invertebrate sequence entries, part 2243.
3862. gbinv2244.seq - Invertebrate sequence entries, part 2244.
3863. gbinv2245.seq - Invertebrate sequence entries, part 2245.
3864. gbinv2246.seq - Invertebrate sequence entries, part 2246.
3865. gbinv2247.seq - Invertebrate sequence entries, part 2247.
3866. gbinv2248.seq - Invertebrate sequence entries, part 2248.
3867. gbinv2249.seq - Invertebrate sequence entries, part 2249.
3868. gbinv225.seq - Invertebrate sequence entries, part 225.
3869. gbinv2250.seq - Invertebrate sequence entries, part 2250.
3870. gbinv2251.seq - Invertebrate sequence entries, part 2251.
3871. gbinv2252.seq - Invertebrate sequence entries, part 2252.
3872. gbinv2253.seq - Invertebrate sequence entries, part 2253.
3873. gbinv2254.seq - Invertebrate sequence entries, part 2254.
3874. gbinv2255.seq - Invertebrate sequence entries, part 2255.
3875. gbinv2256.seq - Invertebrate sequence entries, part 2256.
3876. gbinv2257.seq - Invertebrate sequence entries, part 2257.
3877. gbinv2258.seq - Invertebrate sequence entries, part 2258.
3878. gbinv2259.seq - Invertebrate sequence entries, part 2259.
3879. gbinv226.seq - Invertebrate sequence entries, part 226.
3880. gbinv2260.seq - Invertebrate sequence entries, part 2260.
3881. gbinv2261.seq - Invertebrate sequence entries, part 2261.
3882. gbinv2262.seq - Invertebrate sequence entries, part 2262.
3883. gbinv2263.seq - Invertebrate sequence entries, part 2263.
3884. gbinv2264.seq - Invertebrate sequence entries, part 2264.
3885. gbinv2265.seq - Invertebrate sequence entries, part 2265.
3886. gbinv2266.seq - Invertebrate sequence entries, part 2266.
3887. gbinv2267.seq - Invertebrate sequence entries, part 2267.
3888. gbinv2268.seq - Invertebrate sequence entries, part 2268.
3889. gbinv2269.seq - Invertebrate sequence entries, part 2269.
3890. gbinv227.seq - Invertebrate sequence entries, part 227.
3891. gbinv2270.seq - Invertebrate sequence entries, part 2270.
3892. gbinv2271.seq - Invertebrate sequence entries, part 2271.
3893. gbinv2272.seq - Invertebrate sequence entries, part 2272.
3894. gbinv2273.seq - Invertebrate sequence entries, part 2273.
3895. gbinv2274.seq - Invertebrate sequence entries, part 2274.
3896. gbinv2275.seq - Invertebrate sequence entries, part 2275.
3897. gbinv2276.seq - Invertebrate sequence entries, part 2276.
3898. gbinv2277.seq - Invertebrate sequence entries, part 2277.
3899. gbinv2278.seq - Invertebrate sequence entries, part 2278.
3900. gbinv2279.seq - Invertebrate sequence entries, part 2279.
3901. gbinv228.seq - Invertebrate sequence entries, part 228.
3902. gbinv2280.seq - Invertebrate sequence entries, part 2280.
3903. gbinv2281.seq - Invertebrate sequence entries, part 2281.
3904. gbinv2282.seq - Invertebrate sequence entries, part 2282.
3905. gbinv2283.seq - Invertebrate sequence entries, part 2283.
3906. gbinv2284.seq - Invertebrate sequence entries, part 2284.
3907. gbinv2285.seq - Invertebrate sequence entries, part 2285.
3908. gbinv2286.seq - Invertebrate sequence entries, part 2286.
3909. gbinv2287.seq - Invertebrate sequence entries, part 2287.
3910. gbinv2288.seq - Invertebrate sequence entries, part 2288.
3911. gbinv2289.seq - Invertebrate sequence entries, part 2289.
3912. gbinv229.seq - Invertebrate sequence entries, part 229.
3913. gbinv2290.seq - Invertebrate sequence entries, part 2290.
3914. gbinv2291.seq - Invertebrate sequence entries, part 2291.
3915. gbinv2292.seq - Invertebrate sequence entries, part 2292.
3916. gbinv2293.seq - Invertebrate sequence entries, part 2293.
3917. gbinv2294.seq - Invertebrate sequence entries, part 2294.
3918. gbinv2295.seq - Invertebrate sequence entries, part 2295.
3919. gbinv2296.seq - Invertebrate sequence entries, part 2296.
3920. gbinv2297.seq - Invertebrate sequence entries, part 2297.
3921. gbinv2298.seq - Invertebrate sequence entries, part 2298.
3922. gbinv2299.seq - Invertebrate sequence entries, part 2299.
3923. gbinv23.seq - Invertebrate sequence entries, part 23.
3924. gbinv230.seq - Invertebrate sequence entries, part 230.
3925. gbinv2300.seq - Invertebrate sequence entries, part 2300.
3926. gbinv2301.seq - Invertebrate sequence entries, part 2301.
3927. gbinv2302.seq - Invertebrate sequence entries, part 2302.
3928. gbinv2303.seq - Invertebrate sequence entries, part 2303.
3929. gbinv2304.seq - Invertebrate sequence entries, part 2304.
3930. gbinv2305.seq - Invertebrate sequence entries, part 2305.
3931. gbinv2306.seq - Invertebrate sequence entries, part 2306.
3932. gbinv2307.seq - Invertebrate sequence entries, part 2307.
3933. gbinv2308.seq - Invertebrate sequence entries, part 2308.
3934. gbinv2309.seq - Invertebrate sequence entries, part 2309.
3935. gbinv231.seq - Invertebrate sequence entries, part 231.
3936. gbinv2310.seq - Invertebrate sequence entries, part 2310.
3937. gbinv2311.seq - Invertebrate sequence entries, part 2311.
3938. gbinv2312.seq - Invertebrate sequence entries, part 2312.
3939. gbinv2313.seq - Invertebrate sequence entries, part 2313.
3940. gbinv2314.seq - Invertebrate sequence entries, part 2314.
3941. gbinv2315.seq - Invertebrate sequence entries, part 2315.
3942. gbinv2316.seq - Invertebrate sequence entries, part 2316.
3943. gbinv2317.seq - Invertebrate sequence entries, part 2317.
3944. gbinv2318.seq - Invertebrate sequence entries, part 2318.
3945. gbinv2319.seq - Invertebrate sequence entries, part 2319.
3946. gbinv232.seq - Invertebrate sequence entries, part 232.
3947. gbinv2320.seq - Invertebrate sequence entries, part 2320.
3948. gbinv2321.seq - Invertebrate sequence entries, part 2321.
3949. gbinv2322.seq - Invertebrate sequence entries, part 2322.
3950. gbinv2323.seq - Invertebrate sequence entries, part 2323.
3951. gbinv2324.seq - Invertebrate sequence entries, part 2324.
3952. gbinv2325.seq - Invertebrate sequence entries, part 2325.
3953. gbinv2326.seq - Invertebrate sequence entries, part 2326.
3954. gbinv2327.seq - Invertebrate sequence entries, part 2327.
3955. gbinv2328.seq - Invertebrate sequence entries, part 2328.
3956. gbinv2329.seq - Invertebrate sequence entries, part 2329.
3957. gbinv233.seq - Invertebrate sequence entries, part 233.
3958. gbinv2330.seq - Invertebrate sequence entries, part 2330.
3959. gbinv2331.seq - Invertebrate sequence entries, part 2331.
3960. gbinv2332.seq - Invertebrate sequence entries, part 2332.
3961. gbinv2333.seq - Invertebrate sequence entries, part 2333.
3962. gbinv2334.seq - Invertebrate sequence entries, part 2334.
3963. gbinv2335.seq - Invertebrate sequence entries, part 2335.
3964. gbinv2336.seq - Invertebrate sequence entries, part 2336.
3965. gbinv2337.seq - Invertebrate sequence entries, part 2337.
3966. gbinv2338.seq - Invertebrate sequence entries, part 2338.
3967. gbinv2339.seq - Invertebrate sequence entries, part 2339.
3968. gbinv234.seq - Invertebrate sequence entries, part 234.
3969. gbinv2340.seq - Invertebrate sequence entries, part 2340.
3970. gbinv2341.seq - Invertebrate sequence entries, part 2341.
3971. gbinv2342.seq - Invertebrate sequence entries, part 2342.
3972. gbinv2343.seq - Invertebrate sequence entries, part 2343.
3973. gbinv2344.seq - Invertebrate sequence entries, part 2344.
3974. gbinv2345.seq - Invertebrate sequence entries, part 2345.
3975. gbinv2346.seq - Invertebrate sequence entries, part 2346.
3976. gbinv2347.seq - Invertebrate sequence entries, part 2347.
3977. gbinv2348.seq - Invertebrate sequence entries, part 2348.
3978. gbinv2349.seq - Invertebrate sequence entries, part 2349.
3979. gbinv235.seq - Invertebrate sequence entries, part 235.
3980. gbinv2350.seq - Invertebrate sequence entries, part 2350.
3981. gbinv2351.seq - Invertebrate sequence entries, part 2351.
3982. gbinv2352.seq - Invertebrate sequence entries, part 2352.
3983. gbinv2353.seq - Invertebrate sequence entries, part 2353.
3984. gbinv2354.seq - Invertebrate sequence entries, part 2354.
3985. gbinv2355.seq - Invertebrate sequence entries, part 2355.
3986. gbinv2356.seq - Invertebrate sequence entries, part 2356.
3987. gbinv2357.seq - Invertebrate sequence entries, part 2357.
3988. gbinv2358.seq - Invertebrate sequence entries, part 2358.
3989. gbinv2359.seq - Invertebrate sequence entries, part 2359.
3990. gbinv236.seq - Invertebrate sequence entries, part 236.
3991. gbinv2360.seq - Invertebrate sequence entries, part 2360.
3992. gbinv2361.seq - Invertebrate sequence entries, part 2361.
3993. gbinv2362.seq - Invertebrate sequence entries, part 2362.
3994. gbinv2363.seq - Invertebrate sequence entries, part 2363.
3995. gbinv2364.seq - Invertebrate sequence entries, part 2364.
3996. gbinv2365.seq - Invertebrate sequence entries, part 2365.
3997. gbinv2366.seq - Invertebrate sequence entries, part 2366.
3998. gbinv2367.seq - Invertebrate sequence entries, part 2367.
3999. gbinv2368.seq - Invertebrate sequence entries, part 2368.
4000. gbinv2369.seq - Invertebrate sequence entries, part 2369.
4001. gbinv237.seq - Invertebrate sequence entries, part 237.
4002. gbinv2370.seq - Invertebrate sequence entries, part 2370.
4003. gbinv2371.seq - Invertebrate sequence entries, part 2371.
4004. gbinv2372.seq - Invertebrate sequence entries, part 2372.
4005. gbinv2373.seq - Invertebrate sequence entries, part 2373.
4006. gbinv2374.seq - Invertebrate sequence entries, part 2374.
4007. gbinv2375.seq - Invertebrate sequence entries, part 2375.
4008. gbinv2376.seq - Invertebrate sequence entries, part 2376.
4009. gbinv2377.seq - Invertebrate sequence entries, part 2377.
4010. gbinv2378.seq - Invertebrate sequence entries, part 2378.
4011. gbinv2379.seq - Invertebrate sequence entries, part 2379.
4012. gbinv238.seq - Invertebrate sequence entries, part 238.
4013. gbinv2380.seq - Invertebrate sequence entries, part 2380.
4014. gbinv2381.seq - Invertebrate sequence entries, part 2381.
4015. gbinv2382.seq - Invertebrate sequence entries, part 2382.
4016. gbinv2383.seq - Invertebrate sequence entries, part 2383.
4017. gbinv2384.seq - Invertebrate sequence entries, part 2384.
4018. gbinv2385.seq - Invertebrate sequence entries, part 2385.
4019. gbinv2386.seq - Invertebrate sequence entries, part 2386.
4020. gbinv2387.seq - Invertebrate sequence entries, part 2387.
4021. gbinv2388.seq - Invertebrate sequence entries, part 2388.
4022. gbinv2389.seq - Invertebrate sequence entries, part 2389.
4023. gbinv239.seq - Invertebrate sequence entries, part 239.
4024. gbinv2390.seq - Invertebrate sequence entries, part 2390.
4025. gbinv2391.seq - Invertebrate sequence entries, part 2391.
4026. gbinv2392.seq - Invertebrate sequence entries, part 2392.
4027. gbinv2393.seq - Invertebrate sequence entries, part 2393.
4028. gbinv2394.seq - Invertebrate sequence entries, part 2394.
4029. gbinv2395.seq - Invertebrate sequence entries, part 2395.
4030. gbinv2396.seq - Invertebrate sequence entries, part 2396.
4031. gbinv2397.seq - Invertebrate sequence entries, part 2397.
4032. gbinv2398.seq - Invertebrate sequence entries, part 2398.
4033. gbinv2399.seq - Invertebrate sequence entries, part 2399.
4034. gbinv24.seq - Invertebrate sequence entries, part 24.
4035. gbinv240.seq - Invertebrate sequence entries, part 240.
4036. gbinv2400.seq - Invertebrate sequence entries, part 2400.
4037. gbinv2401.seq - Invertebrate sequence entries, part 2401.
4038. gbinv2402.seq - Invertebrate sequence entries, part 2402.
4039. gbinv2403.seq - Invertebrate sequence entries, part 2403.
4040. gbinv2404.seq - Invertebrate sequence entries, part 2404.
4041. gbinv2405.seq - Invertebrate sequence entries, part 2405.
4042. gbinv2406.seq - Invertebrate sequence entries, part 2406.
4043. gbinv2407.seq - Invertebrate sequence entries, part 2407.
4044. gbinv2408.seq - Invertebrate sequence entries, part 2408.
4045. gbinv2409.seq - Invertebrate sequence entries, part 2409.
4046. gbinv241.seq - Invertebrate sequence entries, part 241.
4047. gbinv2410.seq - Invertebrate sequence entries, part 2410.
4048. gbinv2411.seq - Invertebrate sequence entries, part 2411.
4049. gbinv2412.seq - Invertebrate sequence entries, part 2412.
4050. gbinv2413.seq - Invertebrate sequence entries, part 2413.
4051. gbinv2414.seq - Invertebrate sequence entries, part 2414.
4052. gbinv2415.seq - Invertebrate sequence entries, part 2415.
4053. gbinv2416.seq - Invertebrate sequence entries, part 2416.
4054. gbinv2417.seq - Invertebrate sequence entries, part 2417.
4055. gbinv2418.seq - Invertebrate sequence entries, part 2418.
4056. gbinv2419.seq - Invertebrate sequence entries, part 2419.
4057. gbinv242.seq - Invertebrate sequence entries, part 242.
4058. gbinv2420.seq - Invertebrate sequence entries, part 2420.
4059. gbinv2421.seq - Invertebrate sequence entries, part 2421.
4060. gbinv2422.seq - Invertebrate sequence entries, part 2422.
4061. gbinv2423.seq - Invertebrate sequence entries, part 2423.
4062. gbinv2424.seq - Invertebrate sequence entries, part 2424.
4063. gbinv2425.seq - Invertebrate sequence entries, part 2425.
4064. gbinv2426.seq - Invertebrate sequence entries, part 2426.
4065. gbinv2427.seq - Invertebrate sequence entries, part 2427.
4066. gbinv2428.seq - Invertebrate sequence entries, part 2428.
4067. gbinv2429.seq - Invertebrate sequence entries, part 2429.
4068. gbinv243.seq - Invertebrate sequence entries, part 243.
4069. gbinv2430.seq - Invertebrate sequence entries, part 2430.
4070. gbinv2431.seq - Invertebrate sequence entries, part 2431.
4071. gbinv2432.seq - Invertebrate sequence entries, part 2432.
4072. gbinv2433.seq - Invertebrate sequence entries, part 2433.
4073. gbinv2434.seq - Invertebrate sequence entries, part 2434.
4074. gbinv2435.seq - Invertebrate sequence entries, part 2435.
4075. gbinv2436.seq - Invertebrate sequence entries, part 2436.
4076. gbinv2437.seq - Invertebrate sequence entries, part 2437.
4077. gbinv2438.seq - Invertebrate sequence entries, part 2438.
4078. gbinv2439.seq - Invertebrate sequence entries, part 2439.
4079. gbinv244.seq - Invertebrate sequence entries, part 244.
4080. gbinv2440.seq - Invertebrate sequence entries, part 2440.
4081. gbinv2441.seq - Invertebrate sequence entries, part 2441.
4082. gbinv2442.seq - Invertebrate sequence entries, part 2442.
4083. gbinv2443.seq - Invertebrate sequence entries, part 2443.
4084. gbinv2444.seq - Invertebrate sequence entries, part 2444.
4085. gbinv2445.seq - Invertebrate sequence entries, part 2445.
4086. gbinv2446.seq - Invertebrate sequence entries, part 2446.
4087. gbinv2447.seq - Invertebrate sequence entries, part 2447.
4088. gbinv2448.seq - Invertebrate sequence entries, part 2448.
4089. gbinv2449.seq - Invertebrate sequence entries, part 2449.
4090. gbinv245.seq - Invertebrate sequence entries, part 245.
4091. gbinv2450.seq - Invertebrate sequence entries, part 2450.
4092. gbinv2451.seq - Invertebrate sequence entries, part 2451.
4093. gbinv2452.seq - Invertebrate sequence entries, part 2452.
4094. gbinv2453.seq - Invertebrate sequence entries, part 2453.
4095. gbinv2454.seq - Invertebrate sequence entries, part 2454.
4096. gbinv2455.seq - Invertebrate sequence entries, part 2455.
4097. gbinv2456.seq - Invertebrate sequence entries, part 2456.
4098. gbinv2457.seq - Invertebrate sequence entries, part 2457.
4099. gbinv2458.seq - Invertebrate sequence entries, part 2458.
4100. gbinv2459.seq - Invertebrate sequence entries, part 2459.
4101. gbinv246.seq - Invertebrate sequence entries, part 246.
4102. gbinv2460.seq - Invertebrate sequence entries, part 2460.
4103. gbinv2461.seq - Invertebrate sequence entries, part 2461.
4104. gbinv2462.seq - Invertebrate sequence entries, part 2462.
4105. gbinv2463.seq - Invertebrate sequence entries, part 2463.
4106. gbinv2464.seq - Invertebrate sequence entries, part 2464.
4107. gbinv2465.seq - Invertebrate sequence entries, part 2465.
4108. gbinv2466.seq - Invertebrate sequence entries, part 2466.
4109. gbinv2467.seq - Invertebrate sequence entries, part 2467.
4110. gbinv2468.seq - Invertebrate sequence entries, part 2468.
4111. gbinv2469.seq - Invertebrate sequence entries, part 2469.
4112. gbinv247.seq - Invertebrate sequence entries, part 247.
4113. gbinv2470.seq - Invertebrate sequence entries, part 2470.
4114. gbinv2471.seq - Invertebrate sequence entries, part 2471.
4115. gbinv2472.seq - Invertebrate sequence entries, part 2472.
4116. gbinv2473.seq - Invertebrate sequence entries, part 2473.
4117. gbinv2474.seq - Invertebrate sequence entries, part 2474.
4118. gbinv2475.seq - Invertebrate sequence entries, part 2475.
4119. gbinv2476.seq - Invertebrate sequence entries, part 2476.
4120. gbinv2477.seq - Invertebrate sequence entries, part 2477.
4121. gbinv2478.seq - Invertebrate sequence entries, part 2478.
4122. gbinv2479.seq - Invertebrate sequence entries, part 2479.
4123. gbinv248.seq - Invertebrate sequence entries, part 248.
4124. gbinv2480.seq - Invertebrate sequence entries, part 2480.
4125. gbinv2481.seq - Invertebrate sequence entries, part 2481.
4126. gbinv2482.seq - Invertebrate sequence entries, part 2482.
4127. gbinv2483.seq - Invertebrate sequence entries, part 2483.
4128. gbinv2484.seq - Invertebrate sequence entries, part 2484.
4129. gbinv2485.seq - Invertebrate sequence entries, part 2485.
4130. gbinv2486.seq - Invertebrate sequence entries, part 2486.
4131. gbinv2487.seq - Invertebrate sequence entries, part 2487.
4132. gbinv2488.seq - Invertebrate sequence entries, part 2488.
4133. gbinv2489.seq - Invertebrate sequence entries, part 2489.
4134. gbinv249.seq - Invertebrate sequence entries, part 249.
4135. gbinv2490.seq - Invertebrate sequence entries, part 2490.
4136. gbinv2491.seq - Invertebrate sequence entries, part 2491.
4137. gbinv2492.seq - Invertebrate sequence entries, part 2492.
4138. gbinv2493.seq - Invertebrate sequence entries, part 2493.
4139. gbinv2494.seq - Invertebrate sequence entries, part 2494.
4140. gbinv2495.seq - Invertebrate sequence entries, part 2495.
4141. gbinv2496.seq - Invertebrate sequence entries, part 2496.
4142. gbinv2497.seq - Invertebrate sequence entries, part 2497.
4143. gbinv2498.seq - Invertebrate sequence entries, part 2498.
4144. gbinv2499.seq - Invertebrate sequence entries, part 2499.
4145. gbinv25.seq - Invertebrate sequence entries, part 25.
4146. gbinv250.seq - Invertebrate sequence entries, part 250.
4147. gbinv2500.seq - Invertebrate sequence entries, part 2500.
4148. gbinv2501.seq - Invertebrate sequence entries, part 2501.
4149. gbinv2502.seq - Invertebrate sequence entries, part 2502.
4150. gbinv2503.seq - Invertebrate sequence entries, part 2503.
4151. gbinv2504.seq - Invertebrate sequence entries, part 2504.
4152. gbinv2505.seq - Invertebrate sequence entries, part 2505.
4153. gbinv2506.seq - Invertebrate sequence entries, part 2506.
4154. gbinv2507.seq - Invertebrate sequence entries, part 2507.
4155. gbinv2508.seq - Invertebrate sequence entries, part 2508.
4156. gbinv2509.seq - Invertebrate sequence entries, part 2509.
4157. gbinv251.seq - Invertebrate sequence entries, part 251.
4158. gbinv2510.seq - Invertebrate sequence entries, part 2510.
4159. gbinv2511.seq - Invertebrate sequence entries, part 2511.
4160. gbinv2512.seq - Invertebrate sequence entries, part 2512.
4161. gbinv2513.seq - Invertebrate sequence entries, part 2513.
4162. gbinv2514.seq - Invertebrate sequence entries, part 2514.
4163. gbinv2515.seq - Invertebrate sequence entries, part 2515.
4164. gbinv2516.seq - Invertebrate sequence entries, part 2516.
4165. gbinv2517.seq - Invertebrate sequence entries, part 2517.
4166. gbinv2518.seq - Invertebrate sequence entries, part 2518.
4167. gbinv2519.seq - Invertebrate sequence entries, part 2519.
4168. gbinv252.seq - Invertebrate sequence entries, part 252.
4169. gbinv2520.seq - Invertebrate sequence entries, part 2520.
4170. gbinv2521.seq - Invertebrate sequence entries, part 2521.
4171. gbinv2522.seq - Invertebrate sequence entries, part 2522.
4172. gbinv2523.seq - Invertebrate sequence entries, part 2523.
4173. gbinv2524.seq - Invertebrate sequence entries, part 2524.
4174. gbinv2525.seq - Invertebrate sequence entries, part 2525.
4175. gbinv2526.seq - Invertebrate sequence entries, part 2526.
4176. gbinv2527.seq - Invertebrate sequence entries, part 2527.
4177. gbinv2528.seq - Invertebrate sequence entries, part 2528.
4178. gbinv2529.seq - Invertebrate sequence entries, part 2529.
4179. gbinv253.seq - Invertebrate sequence entries, part 253.
4180. gbinv2530.seq - Invertebrate sequence entries, part 2530.
4181. gbinv2531.seq - Invertebrate sequence entries, part 2531.
4182. gbinv2532.seq - Invertebrate sequence entries, part 2532.
4183. gbinv2533.seq - Invertebrate sequence entries, part 2533.
4184. gbinv2534.seq - Invertebrate sequence entries, part 2534.
4185. gbinv2535.seq - Invertebrate sequence entries, part 2535.
4186. gbinv2536.seq - Invertebrate sequence entries, part 2536.
4187. gbinv2537.seq - Invertebrate sequence entries, part 2537.
4188. gbinv2538.seq - Invertebrate sequence entries, part 2538.
4189. gbinv2539.seq - Invertebrate sequence entries, part 2539.
4190. gbinv254.seq - Invertebrate sequence entries, part 254.
4191. gbinv2540.seq - Invertebrate sequence entries, part 2540.
4192. gbinv2541.seq - Invertebrate sequence entries, part 2541.
4193. gbinv2542.seq - Invertebrate sequence entries, part 2542.
4194. gbinv2543.seq - Invertebrate sequence entries, part 2543.
4195. gbinv2544.seq - Invertebrate sequence entries, part 2544.
4196. gbinv2545.seq - Invertebrate sequence entries, part 2545.
4197. gbinv2546.seq - Invertebrate sequence entries, part 2546.
4198. gbinv2547.seq - Invertebrate sequence entries, part 2547.
4199. gbinv2548.seq - Invertebrate sequence entries, part 2548.
4200. gbinv2549.seq - Invertebrate sequence entries, part 2549.
4201. gbinv255.seq - Invertebrate sequence entries, part 255.
4202. gbinv2550.seq - Invertebrate sequence entries, part 2550.
4203. gbinv2551.seq - Invertebrate sequence entries, part 2551.
4204. gbinv2552.seq - Invertebrate sequence entries, part 2552.
4205. gbinv2553.seq - Invertebrate sequence entries, part 2553.
4206. gbinv2554.seq - Invertebrate sequence entries, part 2554.
4207. gbinv2555.seq - Invertebrate sequence entries, part 2555.
4208. gbinv2556.seq - Invertebrate sequence entries, part 2556.
4209. gbinv2557.seq - Invertebrate sequence entries, part 2557.
4210. gbinv2558.seq - Invertebrate sequence entries, part 2558.
4211. gbinv2559.seq - Invertebrate sequence entries, part 2559.
4212. gbinv256.seq - Invertebrate sequence entries, part 256.
4213. gbinv2560.seq - Invertebrate sequence entries, part 2560.
4214. gbinv2561.seq - Invertebrate sequence entries, part 2561.
4215. gbinv257.seq - Invertebrate sequence entries, part 257.
4216. gbinv258.seq - Invertebrate sequence entries, part 258.
4217. gbinv259.seq - Invertebrate sequence entries, part 259.
4218. gbinv26.seq - Invertebrate sequence entries, part 26.
4219. gbinv260.seq - Invertebrate sequence entries, part 260.
4220. gbinv261.seq - Invertebrate sequence entries, part 261.
4221. gbinv262.seq - Invertebrate sequence entries, part 262.
4222. gbinv263.seq - Invertebrate sequence entries, part 263.
4223. gbinv264.seq - Invertebrate sequence entries, part 264.
4224. gbinv265.seq - Invertebrate sequence entries, part 265.
4225. gbinv266.seq - Invertebrate sequence entries, part 266.
4226. gbinv267.seq - Invertebrate sequence entries, part 267.
4227. gbinv268.seq - Invertebrate sequence entries, part 268.
4228. gbinv269.seq - Invertebrate sequence entries, part 269.
4229. gbinv27.seq - Invertebrate sequence entries, part 27.
4230. gbinv270.seq - Invertebrate sequence entries, part 270.
4231. gbinv271.seq - Invertebrate sequence entries, part 271.
4232. gbinv272.seq - Invertebrate sequence entries, part 272.
4233. gbinv273.seq - Invertebrate sequence entries, part 273.
4234. gbinv274.seq - Invertebrate sequence entries, part 274.
4235. gbinv275.seq - Invertebrate sequence entries, part 275.
4236. gbinv276.seq - Invertebrate sequence entries, part 276.
4237. gbinv277.seq - Invertebrate sequence entries, part 277.
4238. gbinv278.seq - Invertebrate sequence entries, part 278.
4239. gbinv279.seq - Invertebrate sequence entries, part 279.
4240. gbinv28.seq - Invertebrate sequence entries, part 28.
4241. gbinv280.seq - Invertebrate sequence entries, part 280.
4242. gbinv281.seq - Invertebrate sequence entries, part 281.
4243. gbinv282.seq - Invertebrate sequence entries, part 282.
4244. gbinv283.seq - Invertebrate sequence entries, part 283.
4245. gbinv284.seq - Invertebrate sequence entries, part 284.
4246. gbinv285.seq - Invertebrate sequence entries, part 285.
4247. gbinv286.seq - Invertebrate sequence entries, part 286.
4248. gbinv287.seq - Invertebrate sequence entries, part 287.
4249. gbinv288.seq - Invertebrate sequence entries, part 288.
4250. gbinv289.seq - Invertebrate sequence entries, part 289.
4251. gbinv29.seq - Invertebrate sequence entries, part 29.
4252. gbinv290.seq - Invertebrate sequence entries, part 290.
4253. gbinv291.seq - Invertebrate sequence entries, part 291.
4254. gbinv292.seq - Invertebrate sequence entries, part 292.
4255. gbinv293.seq - Invertebrate sequence entries, part 293.
4256. gbinv294.seq - Invertebrate sequence entries, part 294.
4257. gbinv295.seq - Invertebrate sequence entries, part 295.
4258. gbinv296.seq - Invertebrate sequence entries, part 296.
4259. gbinv297.seq - Invertebrate sequence entries, part 297.
4260. gbinv298.seq - Invertebrate sequence entries, part 298.
4261. gbinv299.seq - Invertebrate sequence entries, part 299.
4262. gbinv3.seq - Invertebrate sequence entries, part 3.
4263. gbinv30.seq - Invertebrate sequence entries, part 30.
4264. gbinv300.seq - Invertebrate sequence entries, part 300.
4265. gbinv301.seq - Invertebrate sequence entries, part 301.
4266. gbinv302.seq - Invertebrate sequence entries, part 302.
4267. gbinv303.seq - Invertebrate sequence entries, part 303.
4268. gbinv304.seq - Invertebrate sequence entries, part 304.
4269. gbinv305.seq - Invertebrate sequence entries, part 305.
4270. gbinv306.seq - Invertebrate sequence entries, part 306.
4271. gbinv307.seq - Invertebrate sequence entries, part 307.
4272. gbinv308.seq - Invertebrate sequence entries, part 308.
4273. gbinv309.seq - Invertebrate sequence entries, part 309.
4274. gbinv31.seq - Invertebrate sequence entries, part 31.
4275. gbinv310.seq - Invertebrate sequence entries, part 310.
4276. gbinv311.seq - Invertebrate sequence entries, part 311.
4277. gbinv312.seq - Invertebrate sequence entries, part 312.
4278. gbinv313.seq - Invertebrate sequence entries, part 313.
4279. gbinv314.seq - Invertebrate sequence entries, part 314.
4280. gbinv315.seq - Invertebrate sequence entries, part 315.
4281. gbinv316.seq - Invertebrate sequence entries, part 316.
4282. gbinv317.seq - Invertebrate sequence entries, part 317.
4283. gbinv318.seq - Invertebrate sequence entries, part 318.
4284. gbinv319.seq - Invertebrate sequence entries, part 319.
4285. gbinv32.seq - Invertebrate sequence entries, part 32.
4286. gbinv320.seq - Invertebrate sequence entries, part 320.
4287. gbinv321.seq - Invertebrate sequence entries, part 321.
4288. gbinv322.seq - Invertebrate sequence entries, part 322.
4289. gbinv323.seq - Invertebrate sequence entries, part 323.
4290. gbinv324.seq - Invertebrate sequence entries, part 324.
4291. gbinv325.seq - Invertebrate sequence entries, part 325.
4292. gbinv326.seq - Invertebrate sequence entries, part 326.
4293. gbinv327.seq - Invertebrate sequence entries, part 327.
4294. gbinv328.seq - Invertebrate sequence entries, part 328.
4295. gbinv329.seq - Invertebrate sequence entries, part 329.
4296. gbinv33.seq - Invertebrate sequence entries, part 33.
4297. gbinv330.seq - Invertebrate sequence entries, part 330.
4298. gbinv331.seq - Invertebrate sequence entries, part 331.
4299. gbinv332.seq - Invertebrate sequence entries, part 332.
4300. gbinv333.seq - Invertebrate sequence entries, part 333.
4301. gbinv334.seq - Invertebrate sequence entries, part 334.
4302. gbinv335.seq - Invertebrate sequence entries, part 335.
4303. gbinv336.seq - Invertebrate sequence entries, part 336.
4304. gbinv337.seq - Invertebrate sequence entries, part 337.
4305. gbinv338.seq - Invertebrate sequence entries, part 338.
4306. gbinv339.seq - Invertebrate sequence entries, part 339.
4307. gbinv34.seq - Invertebrate sequence entries, part 34.
4308. gbinv340.seq - Invertebrate sequence entries, part 340.
4309. gbinv341.seq - Invertebrate sequence entries, part 341.
4310. gbinv342.seq - Invertebrate sequence entries, part 342.
4311. gbinv343.seq - Invertebrate sequence entries, part 343.
4312. gbinv344.seq - Invertebrate sequence entries, part 344.
4313. gbinv345.seq - Invertebrate sequence entries, part 345.
4314. gbinv346.seq - Invertebrate sequence entries, part 346.
4315. gbinv347.seq - Invertebrate sequence entries, part 347.
4316. gbinv348.seq - Invertebrate sequence entries, part 348.
4317. gbinv349.seq - Invertebrate sequence entries, part 349.
4318. gbinv35.seq - Invertebrate sequence entries, part 35.
4319. gbinv350.seq - Invertebrate sequence entries, part 350.
4320. gbinv351.seq - Invertebrate sequence entries, part 351.
4321. gbinv352.seq - Invertebrate sequence entries, part 352.
4322. gbinv353.seq - Invertebrate sequence entries, part 353.
4323. gbinv354.seq - Invertebrate sequence entries, part 354.
4324. gbinv355.seq - Invertebrate sequence entries, part 355.
4325. gbinv356.seq - Invertebrate sequence entries, part 356.
4326. gbinv357.seq - Invertebrate sequence entries, part 357.
4327. gbinv358.seq - Invertebrate sequence entries, part 358.
4328. gbinv359.seq - Invertebrate sequence entries, part 359.
4329. gbinv36.seq - Invertebrate sequence entries, part 36.
4330. gbinv360.seq - Invertebrate sequence entries, part 360.
4331. gbinv361.seq - Invertebrate sequence entries, part 361.
4332. gbinv362.seq - Invertebrate sequence entries, part 362.
4333. gbinv363.seq - Invertebrate sequence entries, part 363.
4334. gbinv364.seq - Invertebrate sequence entries, part 364.
4335. gbinv365.seq - Invertebrate sequence entries, part 365.
4336. gbinv366.seq - Invertebrate sequence entries, part 366.
4337. gbinv367.seq - Invertebrate sequence entries, part 367.
4338. gbinv368.seq - Invertebrate sequence entries, part 368.
4339. gbinv369.seq - Invertebrate sequence entries, part 369.
4340. gbinv37.seq - Invertebrate sequence entries, part 37.
4341. gbinv370.seq - Invertebrate sequence entries, part 370.
4342. gbinv371.seq - Invertebrate sequence entries, part 371.
4343. gbinv372.seq - Invertebrate sequence entries, part 372.
4344. gbinv373.seq - Invertebrate sequence entries, part 373.
4345. gbinv374.seq - Invertebrate sequence entries, part 374.
4346. gbinv375.seq - Invertebrate sequence entries, part 375.
4347. gbinv376.seq - Invertebrate sequence entries, part 376.
4348. gbinv377.seq - Invertebrate sequence entries, part 377.
4349. gbinv378.seq - Invertebrate sequence entries, part 378.
4350. gbinv379.seq - Invertebrate sequence entries, part 379.
4351. gbinv38.seq - Invertebrate sequence entries, part 38.
4352. gbinv380.seq - Invertebrate sequence entries, part 380.
4353. gbinv381.seq - Invertebrate sequence entries, part 381.
4354. gbinv382.seq - Invertebrate sequence entries, part 382.
4355. gbinv383.seq - Invertebrate sequence entries, part 383.
4356. gbinv384.seq - Invertebrate sequence entries, part 384.
4357. gbinv385.seq - Invertebrate sequence entries, part 385.
4358. gbinv386.seq - Invertebrate sequence entries, part 386.
4359. gbinv387.seq - Invertebrate sequence entries, part 387.
4360. gbinv388.seq - Invertebrate sequence entries, part 388.
4361. gbinv389.seq - Invertebrate sequence entries, part 389.
4362. gbinv39.seq - Invertebrate sequence entries, part 39.
4363. gbinv390.seq - Invertebrate sequence entries, part 390.
4364. gbinv391.seq - Invertebrate sequence entries, part 391.
4365. gbinv392.seq - Invertebrate sequence entries, part 392.
4366. gbinv393.seq - Invertebrate sequence entries, part 393.
4367. gbinv394.seq - Invertebrate sequence entries, part 394.
4368. gbinv395.seq - Invertebrate sequence entries, part 395.
4369. gbinv396.seq - Invertebrate sequence entries, part 396.
4370. gbinv397.seq - Invertebrate sequence entries, part 397.
4371. gbinv398.seq - Invertebrate sequence entries, part 398.
4372. gbinv399.seq - Invertebrate sequence entries, part 399.
4373. gbinv4.seq - Invertebrate sequence entries, part 4.
4374. gbinv40.seq - Invertebrate sequence entries, part 40.
4375. gbinv400.seq - Invertebrate sequence entries, part 400.
4376. gbinv401.seq - Invertebrate sequence entries, part 401.
4377. gbinv402.seq - Invertebrate sequence entries, part 402.
4378. gbinv403.seq - Invertebrate sequence entries, part 403.
4379. gbinv404.seq - Invertebrate sequence entries, part 404.
4380. gbinv405.seq - Invertebrate sequence entries, part 405.
4381. gbinv406.seq - Invertebrate sequence entries, part 406.
4382. gbinv407.seq - Invertebrate sequence entries, part 407.
4383. gbinv408.seq - Invertebrate sequence entries, part 408.
4384. gbinv409.seq - Invertebrate sequence entries, part 409.
4385. gbinv41.seq - Invertebrate sequence entries, part 41.
4386. gbinv410.seq - Invertebrate sequence entries, part 410.
4387. gbinv411.seq - Invertebrate sequence entries, part 411.
4388. gbinv412.seq - Invertebrate sequence entries, part 412.
4389. gbinv413.seq - Invertebrate sequence entries, part 413.
4390. gbinv414.seq - Invertebrate sequence entries, part 414.
4391. gbinv415.seq - Invertebrate sequence entries, part 415.
4392. gbinv416.seq - Invertebrate sequence entries, part 416.
4393. gbinv417.seq - Invertebrate sequence entries, part 417.
4394. gbinv418.seq - Invertebrate sequence entries, part 418.
4395. gbinv419.seq - Invertebrate sequence entries, part 419.
4396. gbinv42.seq - Invertebrate sequence entries, part 42.
4397. gbinv420.seq - Invertebrate sequence entries, part 420.
4398. gbinv421.seq - Invertebrate sequence entries, part 421.
4399. gbinv422.seq - Invertebrate sequence entries, part 422.
4400. gbinv423.seq - Invertebrate sequence entries, part 423.
4401. gbinv424.seq - Invertebrate sequence entries, part 424.
4402. gbinv425.seq - Invertebrate sequence entries, part 425.
4403. gbinv426.seq - Invertebrate sequence entries, part 426.
4404. gbinv427.seq - Invertebrate sequence entries, part 427.
4405. gbinv428.seq - Invertebrate sequence entries, part 428.
4406. gbinv429.seq - Invertebrate sequence entries, part 429.
4407. gbinv43.seq - Invertebrate sequence entries, part 43.
4408. gbinv430.seq - Invertebrate sequence entries, part 430.
4409. gbinv431.seq - Invertebrate sequence entries, part 431.
4410. gbinv432.seq - Invertebrate sequence entries, part 432.
4411. gbinv433.seq - Invertebrate sequence entries, part 433.
4412. gbinv434.seq - Invertebrate sequence entries, part 434.
4413. gbinv435.seq - Invertebrate sequence entries, part 435.
4414. gbinv436.seq - Invertebrate sequence entries, part 436.
4415. gbinv437.seq - Invertebrate sequence entries, part 437.
4416. gbinv438.seq - Invertebrate sequence entries, part 438.
4417. gbinv439.seq - Invertebrate sequence entries, part 439.
4418. gbinv44.seq - Invertebrate sequence entries, part 44.
4419. gbinv440.seq - Invertebrate sequence entries, part 440.
4420. gbinv441.seq - Invertebrate sequence entries, part 441.
4421. gbinv442.seq - Invertebrate sequence entries, part 442.
4422. gbinv443.seq - Invertebrate sequence entries, part 443.
4423. gbinv444.seq - Invertebrate sequence entries, part 444.
4424. gbinv445.seq - Invertebrate sequence entries, part 445.
4425. gbinv446.seq - Invertebrate sequence entries, part 446.
4426. gbinv447.seq - Invertebrate sequence entries, part 447.
4427. gbinv448.seq - Invertebrate sequence entries, part 448.
4428. gbinv449.seq - Invertebrate sequence entries, part 449.
4429. gbinv45.seq - Invertebrate sequence entries, part 45.
4430. gbinv450.seq - Invertebrate sequence entries, part 450.
4431. gbinv451.seq - Invertebrate sequence entries, part 451.
4432. gbinv452.seq - Invertebrate sequence entries, part 452.
4433. gbinv453.seq - Invertebrate sequence entries, part 453.
4434. gbinv454.seq - Invertebrate sequence entries, part 454.
4435. gbinv455.seq - Invertebrate sequence entries, part 455.
4436. gbinv456.seq - Invertebrate sequence entries, part 456.
4437. gbinv457.seq - Invertebrate sequence entries, part 457.
4438. gbinv458.seq - Invertebrate sequence entries, part 458.
4439. gbinv459.seq - Invertebrate sequence entries, part 459.
4440. gbinv46.seq - Invertebrate sequence entries, part 46.
4441. gbinv460.seq - Invertebrate sequence entries, part 460.
4442. gbinv461.seq - Invertebrate sequence entries, part 461.
4443. gbinv462.seq - Invertebrate sequence entries, part 462.
4444. gbinv463.seq - Invertebrate sequence entries, part 463.
4445. gbinv464.seq - Invertebrate sequence entries, part 464.
4446. gbinv465.seq - Invertebrate sequence entries, part 465.
4447. gbinv466.seq - Invertebrate sequence entries, part 466.
4448. gbinv467.seq - Invertebrate sequence entries, part 467.
4449. gbinv468.seq - Invertebrate sequence entries, part 468.
4450. gbinv469.seq - Invertebrate sequence entries, part 469.
4451. gbinv47.seq - Invertebrate sequence entries, part 47.
4452. gbinv470.seq - Invertebrate sequence entries, part 470.
4453. gbinv471.seq - Invertebrate sequence entries, part 471.
4454. gbinv472.seq - Invertebrate sequence entries, part 472.
4455. gbinv473.seq - Invertebrate sequence entries, part 473.
4456. gbinv474.seq - Invertebrate sequence entries, part 474.
4457. gbinv475.seq - Invertebrate sequence entries, part 475.
4458. gbinv476.seq - Invertebrate sequence entries, part 476.
4459. gbinv477.seq - Invertebrate sequence entries, part 477.
4460. gbinv478.seq - Invertebrate sequence entries, part 478.
4461. gbinv479.seq - Invertebrate sequence entries, part 479.
4462. gbinv48.seq - Invertebrate sequence entries, part 48.
4463. gbinv480.seq - Invertebrate sequence entries, part 480.
4464. gbinv481.seq - Invertebrate sequence entries, part 481.
4465. gbinv482.seq - Invertebrate sequence entries, part 482.
4466. gbinv483.seq - Invertebrate sequence entries, part 483.
4467. gbinv484.seq - Invertebrate sequence entries, part 484.
4468. gbinv485.seq - Invertebrate sequence entries, part 485.
4469. gbinv486.seq - Invertebrate sequence entries, part 486.
4470. gbinv487.seq - Invertebrate sequence entries, part 487.
4471. gbinv488.seq - Invertebrate sequence entries, part 488.
4472. gbinv489.seq - Invertebrate sequence entries, part 489.
4473. gbinv49.seq - Invertebrate sequence entries, part 49.
4474. gbinv490.seq - Invertebrate sequence entries, part 490.
4475. gbinv491.seq - Invertebrate sequence entries, part 491.
4476. gbinv492.seq - Invertebrate sequence entries, part 492.
4477. gbinv493.seq - Invertebrate sequence entries, part 493.
4478. gbinv494.seq - Invertebrate sequence entries, part 494.
4479. gbinv495.seq - Invertebrate sequence entries, part 495.
4480. gbinv496.seq - Invertebrate sequence entries, part 496.
4481. gbinv497.seq - Invertebrate sequence entries, part 497.
4482. gbinv498.seq - Invertebrate sequence entries, part 498.
4483. gbinv499.seq - Invertebrate sequence entries, part 499.
4484. gbinv5.seq - Invertebrate sequence entries, part 5.
4485. gbinv50.seq - Invertebrate sequence entries, part 50.
4486. gbinv500.seq - Invertebrate sequence entries, part 500.
4487. gbinv501.seq - Invertebrate sequence entries, part 501.
4488. gbinv502.seq - Invertebrate sequence entries, part 502.
4489. gbinv503.seq - Invertebrate sequence entries, part 503.
4490. gbinv504.seq - Invertebrate sequence entries, part 504.
4491. gbinv505.seq - Invertebrate sequence entries, part 505.
4492. gbinv506.seq - Invertebrate sequence entries, part 506.
4493. gbinv507.seq - Invertebrate sequence entries, part 507.
4494. gbinv508.seq - Invertebrate sequence entries, part 508.
4495. gbinv509.seq - Invertebrate sequence entries, part 509.
4496. gbinv51.seq - Invertebrate sequence entries, part 51.
4497. gbinv510.seq - Invertebrate sequence entries, part 510.
4498. gbinv511.seq - Invertebrate sequence entries, part 511.
4499. gbinv512.seq - Invertebrate sequence entries, part 512.
4500. gbinv513.seq - Invertebrate sequence entries, part 513.
4501. gbinv514.seq - Invertebrate sequence entries, part 514.
4502. gbinv515.seq - Invertebrate sequence entries, part 515.
4503. gbinv516.seq - Invertebrate sequence entries, part 516.
4504. gbinv517.seq - Invertebrate sequence entries, part 517.
4505. gbinv518.seq - Invertebrate sequence entries, part 518.
4506. gbinv519.seq - Invertebrate sequence entries, part 519.
4507. gbinv52.seq - Invertebrate sequence entries, part 52.
4508. gbinv520.seq - Invertebrate sequence entries, part 520.
4509. gbinv521.seq - Invertebrate sequence entries, part 521.
4510. gbinv522.seq - Invertebrate sequence entries, part 522.
4511. gbinv523.seq - Invertebrate sequence entries, part 523.
4512. gbinv524.seq - Invertebrate sequence entries, part 524.
4513. gbinv525.seq - Invertebrate sequence entries, part 525.
4514. gbinv526.seq - Invertebrate sequence entries, part 526.
4515. gbinv527.seq - Invertebrate sequence entries, part 527.
4516. gbinv528.seq - Invertebrate sequence entries, part 528.
4517. gbinv529.seq - Invertebrate sequence entries, part 529.
4518. gbinv53.seq - Invertebrate sequence entries, part 53.
4519. gbinv530.seq - Invertebrate sequence entries, part 530.
4520. gbinv531.seq - Invertebrate sequence entries, part 531.
4521. gbinv532.seq - Invertebrate sequence entries, part 532.
4522. gbinv533.seq - Invertebrate sequence entries, part 533.
4523. gbinv534.seq - Invertebrate sequence entries, part 534.
4524. gbinv535.seq - Invertebrate sequence entries, part 535.
4525. gbinv536.seq - Invertebrate sequence entries, part 536.
4526. gbinv537.seq - Invertebrate sequence entries, part 537.
4527. gbinv538.seq - Invertebrate sequence entries, part 538.
4528. gbinv539.seq - Invertebrate sequence entries, part 539.
4529. gbinv54.seq - Invertebrate sequence entries, part 54.
4530. gbinv540.seq - Invertebrate sequence entries, part 540.
4531. gbinv541.seq - Invertebrate sequence entries, part 541.
4532. gbinv542.seq - Invertebrate sequence entries, part 542.
4533. gbinv543.seq - Invertebrate sequence entries, part 543.
4534. gbinv544.seq - Invertebrate sequence entries, part 544.
4535. gbinv545.seq - Invertebrate sequence entries, part 545.
4536. gbinv546.seq - Invertebrate sequence entries, part 546.
4537. gbinv547.seq - Invertebrate sequence entries, part 547.
4538. gbinv548.seq - Invertebrate sequence entries, part 548.
4539. gbinv549.seq - Invertebrate sequence entries, part 549.
4540. gbinv55.seq - Invertebrate sequence entries, part 55.
4541. gbinv550.seq - Invertebrate sequence entries, part 550.
4542. gbinv551.seq - Invertebrate sequence entries, part 551.
4543. gbinv552.seq - Invertebrate sequence entries, part 552.
4544. gbinv553.seq - Invertebrate sequence entries, part 553.
4545. gbinv554.seq - Invertebrate sequence entries, part 554.
4546. gbinv555.seq - Invertebrate sequence entries, part 555.
4547. gbinv556.seq - Invertebrate sequence entries, part 556.
4548. gbinv557.seq - Invertebrate sequence entries, part 557.
4549. gbinv558.seq - Invertebrate sequence entries, part 558.
4550. gbinv559.seq - Invertebrate sequence entries, part 559.
4551. gbinv56.seq - Invertebrate sequence entries, part 56.
4552. gbinv560.seq - Invertebrate sequence entries, part 560.
4553. gbinv561.seq - Invertebrate sequence entries, part 561.
4554. gbinv562.seq - Invertebrate sequence entries, part 562.
4555. gbinv563.seq - Invertebrate sequence entries, part 563.
4556. gbinv564.seq - Invertebrate sequence entries, part 564.
4557. gbinv565.seq - Invertebrate sequence entries, part 565.
4558. gbinv566.seq - Invertebrate sequence entries, part 566.
4559. gbinv567.seq - Invertebrate sequence entries, part 567.
4560. gbinv568.seq - Invertebrate sequence entries, part 568.
4561. gbinv569.seq - Invertebrate sequence entries, part 569.
4562. gbinv57.seq - Invertebrate sequence entries, part 57.
4563. gbinv570.seq - Invertebrate sequence entries, part 570.
4564. gbinv571.seq - Invertebrate sequence entries, part 571.
4565. gbinv572.seq - Invertebrate sequence entries, part 572.
4566. gbinv573.seq - Invertebrate sequence entries, part 573.
4567. gbinv574.seq - Invertebrate sequence entries, part 574.
4568. gbinv575.seq - Invertebrate sequence entries, part 575.
4569. gbinv576.seq - Invertebrate sequence entries, part 576.
4570. gbinv577.seq - Invertebrate sequence entries, part 577.
4571. gbinv578.seq - Invertebrate sequence entries, part 578.
4572. gbinv579.seq - Invertebrate sequence entries, part 579.
4573. gbinv58.seq - Invertebrate sequence entries, part 58.
4574. gbinv580.seq - Invertebrate sequence entries, part 580.
4575. gbinv581.seq - Invertebrate sequence entries, part 581.
4576. gbinv582.seq - Invertebrate sequence entries, part 582.
4577. gbinv583.seq - Invertebrate sequence entries, part 583.
4578. gbinv584.seq - Invertebrate sequence entries, part 584.
4579. gbinv585.seq - Invertebrate sequence entries, part 585.
4580. gbinv586.seq - Invertebrate sequence entries, part 586.
4581. gbinv587.seq - Invertebrate sequence entries, part 587.
4582. gbinv588.seq - Invertebrate sequence entries, part 588.
4583. gbinv589.seq - Invertebrate sequence entries, part 589.
4584. gbinv59.seq - Invertebrate sequence entries, part 59.
4585. gbinv590.seq - Invertebrate sequence entries, part 590.
4586. gbinv591.seq - Invertebrate sequence entries, part 591.
4587. gbinv592.seq - Invertebrate sequence entries, part 592.
4588. gbinv593.seq - Invertebrate sequence entries, part 593.
4589. gbinv594.seq - Invertebrate sequence entries, part 594.
4590. gbinv595.seq - Invertebrate sequence entries, part 595.
4591. gbinv596.seq - Invertebrate sequence entries, part 596.
4592. gbinv597.seq - Invertebrate sequence entries, part 597.
4593. gbinv598.seq - Invertebrate sequence entries, part 598.
4594. gbinv599.seq - Invertebrate sequence entries, part 599.
4595. gbinv6.seq - Invertebrate sequence entries, part 6.
4596. gbinv60.seq - Invertebrate sequence entries, part 60.
4597. gbinv600.seq - Invertebrate sequence entries, part 600.
4598. gbinv601.seq - Invertebrate sequence entries, part 601.
4599. gbinv602.seq - Invertebrate sequence entries, part 602.
4600. gbinv603.seq - Invertebrate sequence entries, part 603.
4601. gbinv604.seq - Invertebrate sequence entries, part 604.
4602. gbinv605.seq - Invertebrate sequence entries, part 605.
4603. gbinv606.seq - Invertebrate sequence entries, part 606.
4604. gbinv607.seq - Invertebrate sequence entries, part 607.
4605. gbinv608.seq - Invertebrate sequence entries, part 608.
4606. gbinv609.seq - Invertebrate sequence entries, part 609.
4607. gbinv61.seq - Invertebrate sequence entries, part 61.
4608. gbinv610.seq - Invertebrate sequence entries, part 610.
4609. gbinv611.seq - Invertebrate sequence entries, part 611.
4610. gbinv612.seq - Invertebrate sequence entries, part 612.
4611. gbinv613.seq - Invertebrate sequence entries, part 613.
4612. gbinv614.seq - Invertebrate sequence entries, part 614.
4613. gbinv615.seq - Invertebrate sequence entries, part 615.
4614. gbinv616.seq - Invertebrate sequence entries, part 616.
4615. gbinv617.seq - Invertebrate sequence entries, part 617.
4616. gbinv618.seq - Invertebrate sequence entries, part 618.
4617. gbinv619.seq - Invertebrate sequence entries, part 619.
4618. gbinv62.seq - Invertebrate sequence entries, part 62.
4619. gbinv620.seq - Invertebrate sequence entries, part 620.
4620. gbinv621.seq - Invertebrate sequence entries, part 621.
4621. gbinv622.seq - Invertebrate sequence entries, part 622.
4622. gbinv623.seq - Invertebrate sequence entries, part 623.
4623. gbinv624.seq - Invertebrate sequence entries, part 624.
4624. gbinv625.seq - Invertebrate sequence entries, part 625.
4625. gbinv626.seq - Invertebrate sequence entries, part 626.
4626. gbinv627.seq - Invertebrate sequence entries, part 627.
4627. gbinv628.seq - Invertebrate sequence entries, part 628.
4628. gbinv629.seq - Invertebrate sequence entries, part 629.
4629. gbinv63.seq - Invertebrate sequence entries, part 63.
4630. gbinv630.seq - Invertebrate sequence entries, part 630.
4631. gbinv631.seq - Invertebrate sequence entries, part 631.
4632. gbinv632.seq - Invertebrate sequence entries, part 632.
4633. gbinv633.seq - Invertebrate sequence entries, part 633.
4634. gbinv634.seq - Invertebrate sequence entries, part 634.
4635. gbinv635.seq - Invertebrate sequence entries, part 635.
4636. gbinv636.seq - Invertebrate sequence entries, part 636.
4637. gbinv637.seq - Invertebrate sequence entries, part 637.
4638. gbinv638.seq - Invertebrate sequence entries, part 638.
4639. gbinv639.seq - Invertebrate sequence entries, part 639.
4640. gbinv64.seq - Invertebrate sequence entries, part 64.
4641. gbinv640.seq - Invertebrate sequence entries, part 640.
4642. gbinv641.seq - Invertebrate sequence entries, part 641.
4643. gbinv642.seq - Invertebrate sequence entries, part 642.
4644. gbinv643.seq - Invertebrate sequence entries, part 643.
4645. gbinv644.seq - Invertebrate sequence entries, part 644.
4646. gbinv645.seq - Invertebrate sequence entries, part 645.
4647. gbinv646.seq - Invertebrate sequence entries, part 646.
4648. gbinv647.seq - Invertebrate sequence entries, part 647.
4649. gbinv648.seq - Invertebrate sequence entries, part 648.
4650. gbinv649.seq - Invertebrate sequence entries, part 649.
4651. gbinv65.seq - Invertebrate sequence entries, part 65.
4652. gbinv650.seq - Invertebrate sequence entries, part 650.
4653. gbinv651.seq - Invertebrate sequence entries, part 651.
4654. gbinv652.seq - Invertebrate sequence entries, part 652.
4655. gbinv653.seq - Invertebrate sequence entries, part 653.
4656. gbinv654.seq - Invertebrate sequence entries, part 654.
4657. gbinv655.seq - Invertebrate sequence entries, part 655.
4658. gbinv656.seq - Invertebrate sequence entries, part 656.
4659. gbinv657.seq - Invertebrate sequence entries, part 657.
4660. gbinv658.seq - Invertebrate sequence entries, part 658.
4661. gbinv659.seq - Invertebrate sequence entries, part 659.
4662. gbinv66.seq - Invertebrate sequence entries, part 66.
4663. gbinv660.seq - Invertebrate sequence entries, part 660.
4664. gbinv661.seq - Invertebrate sequence entries, part 661.
4665. gbinv662.seq - Invertebrate sequence entries, part 662.
4666. gbinv663.seq - Invertebrate sequence entries, part 663.
4667. gbinv664.seq - Invertebrate sequence entries, part 664.
4668. gbinv665.seq - Invertebrate sequence entries, part 665.
4669. gbinv666.seq - Invertebrate sequence entries, part 666.
4670. gbinv667.seq - Invertebrate sequence entries, part 667.
4671. gbinv668.seq - Invertebrate sequence entries, part 668.
4672. gbinv669.seq - Invertebrate sequence entries, part 669.
4673. gbinv67.seq - Invertebrate sequence entries, part 67.
4674. gbinv670.seq - Invertebrate sequence entries, part 670.
4675. gbinv671.seq - Invertebrate sequence entries, part 671.
4676. gbinv672.seq - Invertebrate sequence entries, part 672.
4677. gbinv673.seq - Invertebrate sequence entries, part 673.
4678. gbinv674.seq - Invertebrate sequence entries, part 674.
4679. gbinv675.seq - Invertebrate sequence entries, part 675.
4680. gbinv676.seq - Invertebrate sequence entries, part 676.
4681. gbinv677.seq - Invertebrate sequence entries, part 677.
4682. gbinv678.seq - Invertebrate sequence entries, part 678.
4683. gbinv679.seq - Invertebrate sequence entries, part 679.
4684. gbinv68.seq - Invertebrate sequence entries, part 68.
4685. gbinv680.seq - Invertebrate sequence entries, part 680.
4686. gbinv681.seq - Invertebrate sequence entries, part 681.
4687. gbinv682.seq - Invertebrate sequence entries, part 682.
4688. gbinv683.seq - Invertebrate sequence entries, part 683.
4689. gbinv684.seq - Invertebrate sequence entries, part 684.
4690. gbinv685.seq - Invertebrate sequence entries, part 685.
4691. gbinv686.seq - Invertebrate sequence entries, part 686.
4692. gbinv687.seq - Invertebrate sequence entries, part 687.
4693. gbinv688.seq - Invertebrate sequence entries, part 688.
4694. gbinv689.seq - Invertebrate sequence entries, part 689.
4695. gbinv69.seq - Invertebrate sequence entries, part 69.
4696. gbinv690.seq - Invertebrate sequence entries, part 690.
4697. gbinv691.seq - Invertebrate sequence entries, part 691.
4698. gbinv692.seq - Invertebrate sequence entries, part 692.
4699. gbinv693.seq - Invertebrate sequence entries, part 693.
4700. gbinv694.seq - Invertebrate sequence entries, part 694.
4701. gbinv695.seq - Invertebrate sequence entries, part 695.
4702. gbinv696.seq - Invertebrate sequence entries, part 696.
4703. gbinv697.seq - Invertebrate sequence entries, part 697.
4704. gbinv698.seq - Invertebrate sequence entries, part 698.
4705. gbinv699.seq - Invertebrate sequence entries, part 699.
4706. gbinv7.seq - Invertebrate sequence entries, part 7.
4707. gbinv70.seq - Invertebrate sequence entries, part 70.
4708. gbinv700.seq - Invertebrate sequence entries, part 700.
4709. gbinv701.seq - Invertebrate sequence entries, part 701.
4710. gbinv702.seq - Invertebrate sequence entries, part 702.
4711. gbinv703.seq - Invertebrate sequence entries, part 703.
4712. gbinv704.seq - Invertebrate sequence entries, part 704.
4713. gbinv705.seq - Invertebrate sequence entries, part 705.
4714. gbinv706.seq - Invertebrate sequence entries, part 706.
4715. gbinv707.seq - Invertebrate sequence entries, part 707.
4716. gbinv708.seq - Invertebrate sequence entries, part 708.
4717. gbinv709.seq - Invertebrate sequence entries, part 709.
4718. gbinv71.seq - Invertebrate sequence entries, part 71.
4719. gbinv710.seq - Invertebrate sequence entries, part 710.
4720. gbinv711.seq - Invertebrate sequence entries, part 711.
4721. gbinv712.seq - Invertebrate sequence entries, part 712.
4722. gbinv713.seq - Invertebrate sequence entries, part 713.
4723. gbinv714.seq - Invertebrate sequence entries, part 714.
4724. gbinv715.seq - Invertebrate sequence entries, part 715.
4725. gbinv716.seq - Invertebrate sequence entries, part 716.
4726. gbinv717.seq - Invertebrate sequence entries, part 717.
4727. gbinv718.seq - Invertebrate sequence entries, part 718.
4728. gbinv719.seq - Invertebrate sequence entries, part 719.
4729. gbinv72.seq - Invertebrate sequence entries, part 72.
4730. gbinv720.seq - Invertebrate sequence entries, part 720.
4731. gbinv721.seq - Invertebrate sequence entries, part 721.
4732. gbinv722.seq - Invertebrate sequence entries, part 722.
4733. gbinv723.seq - Invertebrate sequence entries, part 723.
4734. gbinv724.seq - Invertebrate sequence entries, part 724.
4735. gbinv725.seq - Invertebrate sequence entries, part 725.
4736. gbinv726.seq - Invertebrate sequence entries, part 726.
4737. gbinv727.seq - Invertebrate sequence entries, part 727.
4738. gbinv728.seq - Invertebrate sequence entries, part 728.
4739. gbinv729.seq - Invertebrate sequence entries, part 729.
4740. gbinv73.seq - Invertebrate sequence entries, part 73.
4741. gbinv730.seq - Invertebrate sequence entries, part 730.
4742. gbinv731.seq - Invertebrate sequence entries, part 731.
4743. gbinv732.seq - Invertebrate sequence entries, part 732.
4744. gbinv733.seq - Invertebrate sequence entries, part 733.
4745. gbinv734.seq - Invertebrate sequence entries, part 734.
4746. gbinv735.seq - Invertebrate sequence entries, part 735.
4747. gbinv736.seq - Invertebrate sequence entries, part 736.
4748. gbinv737.seq - Invertebrate sequence entries, part 737.
4749. gbinv738.seq - Invertebrate sequence entries, part 738.
4750. gbinv739.seq - Invertebrate sequence entries, part 739.
4751. gbinv74.seq - Invertebrate sequence entries, part 74.
4752. gbinv740.seq - Invertebrate sequence entries, part 740.
4753. gbinv741.seq - Invertebrate sequence entries, part 741.
4754. gbinv742.seq - Invertebrate sequence entries, part 742.
4755. gbinv743.seq - Invertebrate sequence entries, part 743.
4756. gbinv744.seq - Invertebrate sequence entries, part 744.
4757. gbinv745.seq - Invertebrate sequence entries, part 745.
4758. gbinv746.seq - Invertebrate sequence entries, part 746.
4759. gbinv747.seq - Invertebrate sequence entries, part 747.
4760. gbinv748.seq - Invertebrate sequence entries, part 748.
4761. gbinv749.seq - Invertebrate sequence entries, part 749.
4762. gbinv75.seq - Invertebrate sequence entries, part 75.
4763. gbinv750.seq - Invertebrate sequence entries, part 750.
4764. gbinv751.seq - Invertebrate sequence entries, part 751.
4765. gbinv752.seq - Invertebrate sequence entries, part 752.
4766. gbinv753.seq - Invertebrate sequence entries, part 753.
4767. gbinv754.seq - Invertebrate sequence entries, part 754.
4768. gbinv755.seq - Invertebrate sequence entries, part 755.
4769. gbinv756.seq - Invertebrate sequence entries, part 756.
4770. gbinv757.seq - Invertebrate sequence entries, part 757.
4771. gbinv758.seq - Invertebrate sequence entries, part 758.
4772. gbinv759.seq - Invertebrate sequence entries, part 759.
4773. gbinv76.seq - Invertebrate sequence entries, part 76.
4774. gbinv760.seq - Invertebrate sequence entries, part 760.
4775. gbinv761.seq - Invertebrate sequence entries, part 761.
4776. gbinv762.seq - Invertebrate sequence entries, part 762.
4777. gbinv763.seq - Invertebrate sequence entries, part 763.
4778. gbinv764.seq - Invertebrate sequence entries, part 764.
4779. gbinv765.seq - Invertebrate sequence entries, part 765.
4780. gbinv766.seq - Invertebrate sequence entries, part 766.
4781. gbinv767.seq - Invertebrate sequence entries, part 767.
4782. gbinv768.seq - Invertebrate sequence entries, part 768.
4783. gbinv769.seq - Invertebrate sequence entries, part 769.
4784. gbinv77.seq - Invertebrate sequence entries, part 77.
4785. gbinv770.seq - Invertebrate sequence entries, part 770.
4786. gbinv771.seq - Invertebrate sequence entries, part 771.
4787. gbinv772.seq - Invertebrate sequence entries, part 772.
4788. gbinv773.seq - Invertebrate sequence entries, part 773.
4789. gbinv774.seq - Invertebrate sequence entries, part 774.
4790. gbinv775.seq - Invertebrate sequence entries, part 775.
4791. gbinv776.seq - Invertebrate sequence entries, part 776.
4792. gbinv777.seq - Invertebrate sequence entries, part 777.
4793. gbinv778.seq - Invertebrate sequence entries, part 778.
4794. gbinv779.seq - Invertebrate sequence entries, part 779.
4795. gbinv78.seq - Invertebrate sequence entries, part 78.
4796. gbinv780.seq - Invertebrate sequence entries, part 780.
4797. gbinv781.seq - Invertebrate sequence entries, part 781.
4798. gbinv782.seq - Invertebrate sequence entries, part 782.
4799. gbinv783.seq - Invertebrate sequence entries, part 783.
4800. gbinv784.seq - Invertebrate sequence entries, part 784.
4801. gbinv785.seq - Invertebrate sequence entries, part 785.
4802. gbinv786.seq - Invertebrate sequence entries, part 786.
4803. gbinv787.seq - Invertebrate sequence entries, part 787.
4804. gbinv788.seq - Invertebrate sequence entries, part 788.
4805. gbinv789.seq - Invertebrate sequence entries, part 789.
4806. gbinv79.seq - Invertebrate sequence entries, part 79.
4807. gbinv790.seq - Invertebrate sequence entries, part 790.
4808. gbinv791.seq - Invertebrate sequence entries, part 791.
4809. gbinv792.seq - Invertebrate sequence entries, part 792.
4810. gbinv793.seq - Invertebrate sequence entries, part 793.
4811. gbinv794.seq - Invertebrate sequence entries, part 794.
4812. gbinv795.seq - Invertebrate sequence entries, part 795.
4813. gbinv796.seq - Invertebrate sequence entries, part 796.
4814. gbinv797.seq - Invertebrate sequence entries, part 797.
4815. gbinv798.seq - Invertebrate sequence entries, part 798.
4816. gbinv799.seq - Invertebrate sequence entries, part 799.
4817. gbinv8.seq - Invertebrate sequence entries, part 8.
4818. gbinv80.seq - Invertebrate sequence entries, part 80.
4819. gbinv800.seq - Invertebrate sequence entries, part 800.
4820. gbinv801.seq - Invertebrate sequence entries, part 801.
4821. gbinv802.seq - Invertebrate sequence entries, part 802.
4822. gbinv803.seq - Invertebrate sequence entries, part 803.
4823. gbinv804.seq - Invertebrate sequence entries, part 804.
4824. gbinv805.seq - Invertebrate sequence entries, part 805.
4825. gbinv806.seq - Invertebrate sequence entries, part 806.
4826. gbinv807.seq - Invertebrate sequence entries, part 807.
4827. gbinv808.seq - Invertebrate sequence entries, part 808.
4828. gbinv809.seq - Invertebrate sequence entries, part 809.
4829. gbinv81.seq - Invertebrate sequence entries, part 81.
4830. gbinv810.seq - Invertebrate sequence entries, part 810.
4831. gbinv811.seq - Invertebrate sequence entries, part 811.
4832. gbinv812.seq - Invertebrate sequence entries, part 812.
4833. gbinv813.seq - Invertebrate sequence entries, part 813.
4834. gbinv814.seq - Invertebrate sequence entries, part 814.
4835. gbinv815.seq - Invertebrate sequence entries, part 815.
4836. gbinv816.seq - Invertebrate sequence entries, part 816.
4837. gbinv817.seq - Invertebrate sequence entries, part 817.
4838. gbinv818.seq - Invertebrate sequence entries, part 818.
4839. gbinv819.seq - Invertebrate sequence entries, part 819.
4840. gbinv82.seq - Invertebrate sequence entries, part 82.
4841. gbinv820.seq - Invertebrate sequence entries, part 820.
4842. gbinv821.seq - Invertebrate sequence entries, part 821.
4843. gbinv822.seq - Invertebrate sequence entries, part 822.
4844. gbinv823.seq - Invertebrate sequence entries, part 823.
4845. gbinv824.seq - Invertebrate sequence entries, part 824.
4846. gbinv825.seq - Invertebrate sequence entries, part 825.
4847. gbinv826.seq - Invertebrate sequence entries, part 826.
4848. gbinv827.seq - Invertebrate sequence entries, part 827.
4849. gbinv828.seq - Invertebrate sequence entries, part 828.
4850. gbinv829.seq - Invertebrate sequence entries, part 829.
4851. gbinv83.seq - Invertebrate sequence entries, part 83.
4852. gbinv830.seq - Invertebrate sequence entries, part 830.
4853. gbinv831.seq - Invertebrate sequence entries, part 831.
4854. gbinv832.seq - Invertebrate sequence entries, part 832.
4855. gbinv833.seq - Invertebrate sequence entries, part 833.
4856. gbinv834.seq - Invertebrate sequence entries, part 834.
4857. gbinv835.seq - Invertebrate sequence entries, part 835.
4858. gbinv836.seq - Invertebrate sequence entries, part 836.
4859. gbinv837.seq - Invertebrate sequence entries, part 837.
4860. gbinv838.seq - Invertebrate sequence entries, part 838.
4861. gbinv839.seq - Invertebrate sequence entries, part 839.
4862. gbinv84.seq - Invertebrate sequence entries, part 84.
4863. gbinv840.seq - Invertebrate sequence entries, part 840.
4864. gbinv841.seq - Invertebrate sequence entries, part 841.
4865. gbinv842.seq - Invertebrate sequence entries, part 842.
4866. gbinv843.seq - Invertebrate sequence entries, part 843.
4867. gbinv844.seq - Invertebrate sequence entries, part 844.
4868. gbinv845.seq - Invertebrate sequence entries, part 845.
4869. gbinv846.seq - Invertebrate sequence entries, part 846.
4870. gbinv847.seq - Invertebrate sequence entries, part 847.
4871. gbinv848.seq - Invertebrate sequence entries, part 848.
4872. gbinv849.seq - Invertebrate sequence entries, part 849.
4873. gbinv85.seq - Invertebrate sequence entries, part 85.
4874. gbinv850.seq - Invertebrate sequence entries, part 850.
4875. gbinv851.seq - Invertebrate sequence entries, part 851.
4876. gbinv852.seq - Invertebrate sequence entries, part 852.
4877. gbinv853.seq - Invertebrate sequence entries, part 853.
4878. gbinv854.seq - Invertebrate sequence entries, part 854.
4879. gbinv855.seq - Invertebrate sequence entries, part 855.
4880. gbinv856.seq - Invertebrate sequence entries, part 856.
4881. gbinv857.seq - Invertebrate sequence entries, part 857.
4882. gbinv858.seq - Invertebrate sequence entries, part 858.
4883. gbinv859.seq - Invertebrate sequence entries, part 859.
4884. gbinv86.seq - Invertebrate sequence entries, part 86.
4885. gbinv860.seq - Invertebrate sequence entries, part 860.
4886. gbinv861.seq - Invertebrate sequence entries, part 861.
4887. gbinv862.seq - Invertebrate sequence entries, part 862.
4888. gbinv863.seq - Invertebrate sequence entries, part 863.
4889. gbinv864.seq - Invertebrate sequence entries, part 864.
4890. gbinv865.seq - Invertebrate sequence entries, part 865.
4891. gbinv866.seq - Invertebrate sequence entries, part 866.
4892. gbinv867.seq - Invertebrate sequence entries, part 867.
4893. gbinv868.seq - Invertebrate sequence entries, part 868.
4894. gbinv869.seq - Invertebrate sequence entries, part 869.
4895. gbinv87.seq - Invertebrate sequence entries, part 87.
4896. gbinv870.seq - Invertebrate sequence entries, part 870.
4897. gbinv871.seq - Invertebrate sequence entries, part 871.
4898. gbinv872.seq - Invertebrate sequence entries, part 872.
4899. gbinv873.seq - Invertebrate sequence entries, part 873.
4900. gbinv874.seq - Invertebrate sequence entries, part 874.
4901. gbinv875.seq - Invertebrate sequence entries, part 875.
4902. gbinv876.seq - Invertebrate sequence entries, part 876.
4903. gbinv877.seq - Invertebrate sequence entries, part 877.
4904. gbinv878.seq - Invertebrate sequence entries, part 878.
4905. gbinv879.seq - Invertebrate sequence entries, part 879.
4906. gbinv88.seq - Invertebrate sequence entries, part 88.
4907. gbinv880.seq - Invertebrate sequence entries, part 880.
4908. gbinv881.seq - Invertebrate sequence entries, part 881.
4909. gbinv882.seq - Invertebrate sequence entries, part 882.
4910. gbinv883.seq - Invertebrate sequence entries, part 883.
4911. gbinv884.seq - Invertebrate sequence entries, part 884.
4912. gbinv885.seq - Invertebrate sequence entries, part 885.
4913. gbinv886.seq - Invertebrate sequence entries, part 886.
4914. gbinv887.seq - Invertebrate sequence entries, part 887.
4915. gbinv888.seq - Invertebrate sequence entries, part 888.
4916. gbinv889.seq - Invertebrate sequence entries, part 889.
4917. gbinv89.seq - Invertebrate sequence entries, part 89.
4918. gbinv890.seq - Invertebrate sequence entries, part 890.
4919. gbinv891.seq - Invertebrate sequence entries, part 891.
4920. gbinv892.seq - Invertebrate sequence entries, part 892.
4921. gbinv893.seq - Invertebrate sequence entries, part 893.
4922. gbinv894.seq - Invertebrate sequence entries, part 894.
4923. gbinv895.seq - Invertebrate sequence entries, part 895.
4924. gbinv896.seq - Invertebrate sequence entries, part 896.
4925. gbinv897.seq - Invertebrate sequence entries, part 897.
4926. gbinv898.seq - Invertebrate sequence entries, part 898.
4927. gbinv899.seq - Invertebrate sequence entries, part 899.
4928. gbinv9.seq - Invertebrate sequence entries, part 9.
4929. gbinv90.seq - Invertebrate sequence entries, part 90.
4930. gbinv900.seq - Invertebrate sequence entries, part 900.
4931. gbinv901.seq - Invertebrate sequence entries, part 901.
4932. gbinv902.seq - Invertebrate sequence entries, part 902.
4933. gbinv903.seq - Invertebrate sequence entries, part 903.
4934. gbinv904.seq - Invertebrate sequence entries, part 904.
4935. gbinv905.seq - Invertebrate sequence entries, part 905.
4936. gbinv906.seq - Invertebrate sequence entries, part 906.
4937. gbinv907.seq - Invertebrate sequence entries, part 907.
4938. gbinv908.seq - Invertebrate sequence entries, part 908.
4939. gbinv909.seq - Invertebrate sequence entries, part 909.
4940. gbinv91.seq - Invertebrate sequence entries, part 91.
4941. gbinv910.seq - Invertebrate sequence entries, part 910.
4942. gbinv911.seq - Invertebrate sequence entries, part 911.
4943. gbinv912.seq - Invertebrate sequence entries, part 912.
4944. gbinv913.seq - Invertebrate sequence entries, part 913.
4945. gbinv914.seq - Invertebrate sequence entries, part 914.
4946. gbinv915.seq - Invertebrate sequence entries, part 915.
4947. gbinv916.seq - Invertebrate sequence entries, part 916.
4948. gbinv917.seq - Invertebrate sequence entries, part 917.
4949. gbinv918.seq - Invertebrate sequence entries, part 918.
4950. gbinv919.seq - Invertebrate sequence entries, part 919.
4951. gbinv92.seq - Invertebrate sequence entries, part 92.
4952. gbinv920.seq - Invertebrate sequence entries, part 920.
4953. gbinv921.seq - Invertebrate sequence entries, part 921.
4954. gbinv922.seq - Invertebrate sequence entries, part 922.
4955. gbinv923.seq - Invertebrate sequence entries, part 923.
4956. gbinv924.seq - Invertebrate sequence entries, part 924.
4957. gbinv925.seq - Invertebrate sequence entries, part 925.
4958. gbinv926.seq - Invertebrate sequence entries, part 926.
4959. gbinv927.seq - Invertebrate sequence entries, part 927.
4960. gbinv928.seq - Invertebrate sequence entries, part 928.
4961. gbinv929.seq - Invertebrate sequence entries, part 929.
4962. gbinv93.seq - Invertebrate sequence entries, part 93.
4963. gbinv930.seq - Invertebrate sequence entries, part 930.
4964. gbinv931.seq - Invertebrate sequence entries, part 931.
4965. gbinv932.seq - Invertebrate sequence entries, part 932.
4966. gbinv933.seq - Invertebrate sequence entries, part 933.
4967. gbinv934.seq - Invertebrate sequence entries, part 934.
4968. gbinv935.seq - Invertebrate sequence entries, part 935.
4969. gbinv936.seq - Invertebrate sequence entries, part 936.
4970. gbinv937.seq - Invertebrate sequence entries, part 937.
4971. gbinv938.seq - Invertebrate sequence entries, part 938.
4972. gbinv939.seq - Invertebrate sequence entries, part 939.
4973. gbinv94.seq - Invertebrate sequence entries, part 94.
4974. gbinv940.seq - Invertebrate sequence entries, part 940.
4975. gbinv941.seq - Invertebrate sequence entries, part 941.
4976. gbinv942.seq - Invertebrate sequence entries, part 942.
4977. gbinv943.seq - Invertebrate sequence entries, part 943.
4978. gbinv944.seq - Invertebrate sequence entries, part 944.
4979. gbinv945.seq - Invertebrate sequence entries, part 945.
4980. gbinv946.seq - Invertebrate sequence entries, part 946.
4981. gbinv947.seq - Invertebrate sequence entries, part 947.
4982. gbinv948.seq - Invertebrate sequence entries, part 948.
4983. gbinv949.seq - Invertebrate sequence entries, part 949.
4984. gbinv95.seq - Invertebrate sequence entries, part 95.
4985. gbinv950.seq - Invertebrate sequence entries, part 950.
4986. gbinv951.seq - Invertebrate sequence entries, part 951.
4987. gbinv952.seq - Invertebrate sequence entries, part 952.
4988. gbinv953.seq - Invertebrate sequence entries, part 953.
4989. gbinv954.seq - Invertebrate sequence entries, part 954.
4990. gbinv955.seq - Invertebrate sequence entries, part 955.
4991. gbinv956.seq - Invertebrate sequence entries, part 956.
4992. gbinv957.seq - Invertebrate sequence entries, part 957.
4993. gbinv958.seq - Invertebrate sequence entries, part 958.
4994. gbinv959.seq - Invertebrate sequence entries, part 959.
4995. gbinv96.seq - Invertebrate sequence entries, part 96.
4996. gbinv960.seq - Invertebrate sequence entries, part 960.
4997. gbinv961.seq - Invertebrate sequence entries, part 961.
4998. gbinv962.seq - Invertebrate sequence entries, part 962.
4999. gbinv963.seq - Invertebrate sequence entries, part 963.
5000. gbinv964.seq - Invertebrate sequence entries, part 964.
5001. gbinv965.seq - Invertebrate sequence entries, part 965.
5002. gbinv966.seq - Invertebrate sequence entries, part 966.
5003. gbinv967.seq - Invertebrate sequence entries, part 967.
5004. gbinv968.seq - Invertebrate sequence entries, part 968.
5005. gbinv969.seq - Invertebrate sequence entries, part 969.
5006. gbinv97.seq - Invertebrate sequence entries, part 97.
5007. gbinv970.seq - Invertebrate sequence entries, part 970.
5008. gbinv971.seq - Invertebrate sequence entries, part 971.
5009. gbinv972.seq - Invertebrate sequence entries, part 972.
5010. gbinv973.seq - Invertebrate sequence entries, part 973.
5011. gbinv974.seq - Invertebrate sequence entries, part 974.
5012. gbinv975.seq - Invertebrate sequence entries, part 975.
5013. gbinv976.seq - Invertebrate sequence entries, part 976.
5014. gbinv977.seq - Invertebrate sequence entries, part 977.
5015. gbinv978.seq - Invertebrate sequence entries, part 978.
5016. gbinv979.seq - Invertebrate sequence entries, part 979.
5017. gbinv98.seq - Invertebrate sequence entries, part 98.
5018. gbinv980.seq - Invertebrate sequence entries, part 980.
5019. gbinv981.seq - Invertebrate sequence entries, part 981.
5020. gbinv982.seq - Invertebrate sequence entries, part 982.
5021. gbinv983.seq - Invertebrate sequence entries, part 983.
5022. gbinv984.seq - Invertebrate sequence entries, part 984.
5023. gbinv985.seq - Invertebrate sequence entries, part 985.
5024. gbinv986.seq - Invertebrate sequence entries, part 986.
5025. gbinv987.seq - Invertebrate sequence entries, part 987.
5026. gbinv988.seq - Invertebrate sequence entries, part 988.
5027. gbinv989.seq - Invertebrate sequence entries, part 989.
5028. gbinv99.seq - Invertebrate sequence entries, part 99.
5029. gbinv990.seq - Invertebrate sequence entries, part 990.
5030. gbinv991.seq - Invertebrate sequence entries, part 991.
5031. gbinv992.seq - Invertebrate sequence entries, part 992.
5032. gbinv993.seq - Invertebrate sequence entries, part 993.
5033. gbinv994.seq - Invertebrate sequence entries, part 994.
5034. gbinv995.seq - Invertebrate sequence entries, part 995.
5035. gbinv996.seq - Invertebrate sequence entries, part 996.
5036. gbinv997.seq - Invertebrate sequence entries, part 997.
5037. gbinv998.seq - Invertebrate sequence entries, part 998.
5038. gbinv999.seq - Invertebrate sequence entries, part 999.
5039. gbmam1.seq - Other mammalian sequence entries, part 1.
5040. gbmam10.seq - Other mammalian sequence entries, part 10.
5041. gbmam100.seq - Other mammalian sequence entries, part 100.
5042. gbmam101.seq - Other mammalian sequence entries, part 101.
5043. gbmam102.seq - Other mammalian sequence entries, part 102.
5044. gbmam103.seq - Other mammalian sequence entries, part 103.
5045. gbmam104.seq - Other mammalian sequence entries, part 104.
5046. gbmam105.seq - Other mammalian sequence entries, part 105.
5047. gbmam106.seq - Other mammalian sequence entries, part 106.
5048. gbmam107.seq - Other mammalian sequence entries, part 107.
5049. gbmam108.seq - Other mammalian sequence entries, part 108.
5050. gbmam109.seq - Other mammalian sequence entries, part 109.
5051. gbmam11.seq - Other mammalian sequence entries, part 11.
5052. gbmam110.seq - Other mammalian sequence entries, part 110.
5053. gbmam111.seq - Other mammalian sequence entries, part 111.
5054. gbmam112.seq - Other mammalian sequence entries, part 112.
5055. gbmam113.seq - Other mammalian sequence entries, part 113.
5056. gbmam114.seq - Other mammalian sequence entries, part 114.
5057. gbmam115.seq - Other mammalian sequence entries, part 115.
5058. gbmam116.seq - Other mammalian sequence entries, part 116.
5059. gbmam117.seq - Other mammalian sequence entries, part 117.
5060. gbmam118.seq - Other mammalian sequence entries, part 118.
5061. gbmam119.seq - Other mammalian sequence entries, part 119.
5062. gbmam12.seq - Other mammalian sequence entries, part 12.
5063. gbmam120.seq - Other mammalian sequence entries, part 120.
5064. gbmam121.seq - Other mammalian sequence entries, part 121.
5065. gbmam122.seq - Other mammalian sequence entries, part 122.
5066. gbmam123.seq - Other mammalian sequence entries, part 123.
5067. gbmam124.seq - Other mammalian sequence entries, part 124.
5068. gbmam125.seq - Other mammalian sequence entries, part 125.
5069. gbmam126.seq - Other mammalian sequence entries, part 126.
5070. gbmam127.seq - Other mammalian sequence entries, part 127.
5071. gbmam128.seq - Other mammalian sequence entries, part 128.
5072. gbmam129.seq - Other mammalian sequence entries, part 129.
5073. gbmam13.seq - Other mammalian sequence entries, part 13.
5074. gbmam130.seq - Other mammalian sequence entries, part 130.
5075. gbmam131.seq - Other mammalian sequence entries, part 131.
5076. gbmam132.seq - Other mammalian sequence entries, part 132.
5077. gbmam133.seq - Other mammalian sequence entries, part 133.
5078. gbmam134.seq - Other mammalian sequence entries, part 134.
5079. gbmam135.seq - Other mammalian sequence entries, part 135.
5080. gbmam136.seq - Other mammalian sequence entries, part 136.
5081. gbmam137.seq - Other mammalian sequence entries, part 137.
5082. gbmam138.seq - Other mammalian sequence entries, part 138.
5083. gbmam139.seq - Other mammalian sequence entries, part 139.
5084. gbmam14.seq - Other mammalian sequence entries, part 14.
5085. gbmam140.seq - Other mammalian sequence entries, part 140.
5086. gbmam141.seq - Other mammalian sequence entries, part 141.
5087. gbmam142.seq - Other mammalian sequence entries, part 142.
5088. gbmam143.seq - Other mammalian sequence entries, part 143.
5089. gbmam144.seq - Other mammalian sequence entries, part 144.
5090. gbmam145.seq - Other mammalian sequence entries, part 145.
5091. gbmam146.seq - Other mammalian sequence entries, part 146.
5092. gbmam147.seq - Other mammalian sequence entries, part 147.
5093. gbmam148.seq - Other mammalian sequence entries, part 148.
5094. gbmam149.seq - Other mammalian sequence entries, part 149.
5095. gbmam15.seq - Other mammalian sequence entries, part 15.
5096. gbmam150.seq - Other mammalian sequence entries, part 150.
5097. gbmam151.seq - Other mammalian sequence entries, part 151.
5098. gbmam152.seq - Other mammalian sequence entries, part 152.
5099. gbmam153.seq - Other mammalian sequence entries, part 153.
5100. gbmam154.seq - Other mammalian sequence entries, part 154.
5101. gbmam155.seq - Other mammalian sequence entries, part 155.
5102. gbmam156.seq - Other mammalian sequence entries, part 156.
5103. gbmam157.seq - Other mammalian sequence entries, part 157.
5104. gbmam158.seq - Other mammalian sequence entries, part 158.
5105. gbmam159.seq - Other mammalian sequence entries, part 159.
5106. gbmam16.seq - Other mammalian sequence entries, part 16.
5107. gbmam160.seq - Other mammalian sequence entries, part 160.
5108. gbmam161.seq - Other mammalian sequence entries, part 161.
5109. gbmam162.seq - Other mammalian sequence entries, part 162.
5110. gbmam163.seq - Other mammalian sequence entries, part 163.
5111. gbmam164.seq - Other mammalian sequence entries, part 164.
5112. gbmam165.seq - Other mammalian sequence entries, part 165.
5113. gbmam166.seq - Other mammalian sequence entries, part 166.
5114. gbmam167.seq - Other mammalian sequence entries, part 167.
5115. gbmam168.seq - Other mammalian sequence entries, part 168.
5116. gbmam169.seq - Other mammalian sequence entries, part 169.
5117. gbmam17.seq - Other mammalian sequence entries, part 17.
5118. gbmam170.seq - Other mammalian sequence entries, part 170.
5119. gbmam171.seq - Other mammalian sequence entries, part 171.
5120. gbmam172.seq - Other mammalian sequence entries, part 172.
5121. gbmam173.seq - Other mammalian sequence entries, part 173.
5122. gbmam174.seq - Other mammalian sequence entries, part 174.
5123. gbmam175.seq - Other mammalian sequence entries, part 175.
5124. gbmam176.seq - Other mammalian sequence entries, part 176.
5125. gbmam177.seq - Other mammalian sequence entries, part 177.
5126. gbmam178.seq - Other mammalian sequence entries, part 178.
5127. gbmam179.seq - Other mammalian sequence entries, part 179.
5128. gbmam18.seq - Other mammalian sequence entries, part 18.
5129. gbmam180.seq - Other mammalian sequence entries, part 180.
5130. gbmam181.seq - Other mammalian sequence entries, part 181.
5131. gbmam182.seq - Other mammalian sequence entries, part 182.
5132. gbmam183.seq - Other mammalian sequence entries, part 183.
5133. gbmam184.seq - Other mammalian sequence entries, part 184.
5134. gbmam185.seq - Other mammalian sequence entries, part 185.
5135. gbmam186.seq - Other mammalian sequence entries, part 186.
5136. gbmam187.seq - Other mammalian sequence entries, part 187.
5137. gbmam188.seq - Other mammalian sequence entries, part 188.
5138. gbmam189.seq - Other mammalian sequence entries, part 189.
5139. gbmam19.seq - Other mammalian sequence entries, part 19.
5140. gbmam190.seq - Other mammalian sequence entries, part 190.
5141. gbmam191.seq - Other mammalian sequence entries, part 191.
5142. gbmam192.seq - Other mammalian sequence entries, part 192.
5143. gbmam193.seq - Other mammalian sequence entries, part 193.
5144. gbmam194.seq - Other mammalian sequence entries, part 194.
5145. gbmam195.seq - Other mammalian sequence entries, part 195.
5146. gbmam196.seq - Other mammalian sequence entries, part 196.
5147. gbmam197.seq - Other mammalian sequence entries, part 197.
5148. gbmam198.seq - Other mammalian sequence entries, part 198.
5149. gbmam199.seq - Other mammalian sequence entries, part 199.
5150. gbmam2.seq - Other mammalian sequence entries, part 2.
5151. gbmam20.seq - Other mammalian sequence entries, part 20.
5152. gbmam200.seq - Other mammalian sequence entries, part 200.
5153. gbmam201.seq - Other mammalian sequence entries, part 201.
5154. gbmam202.seq - Other mammalian sequence entries, part 202.
5155. gbmam203.seq - Other mammalian sequence entries, part 203.
5156. gbmam204.seq - Other mammalian sequence entries, part 204.
5157. gbmam205.seq - Other mammalian sequence entries, part 205.
5158. gbmam206.seq - Other mammalian sequence entries, part 206.
5159. gbmam207.seq - Other mammalian sequence entries, part 207.
5160. gbmam208.seq - Other mammalian sequence entries, part 208.
5161. gbmam209.seq - Other mammalian sequence entries, part 209.
5162. gbmam21.seq - Other mammalian sequence entries, part 21.
5163. gbmam210.seq - Other mammalian sequence entries, part 210.
5164. gbmam211.seq - Other mammalian sequence entries, part 211.
5165. gbmam212.seq - Other mammalian sequence entries, part 212.
5166. gbmam213.seq - Other mammalian sequence entries, part 213.
5167. gbmam214.seq - Other mammalian sequence entries, part 214.
5168. gbmam215.seq - Other mammalian sequence entries, part 215.
5169. gbmam216.seq - Other mammalian sequence entries, part 216.
5170. gbmam217.seq - Other mammalian sequence entries, part 217.
5171. gbmam218.seq - Other mammalian sequence entries, part 218.
5172. gbmam219.seq - Other mammalian sequence entries, part 219.
5173. gbmam22.seq - Other mammalian sequence entries, part 22.
5174. gbmam220.seq - Other mammalian sequence entries, part 220.
5175. gbmam221.seq - Other mammalian sequence entries, part 221.
5176. gbmam222.seq - Other mammalian sequence entries, part 222.
5177. gbmam223.seq - Other mammalian sequence entries, part 223.
5178. gbmam224.seq - Other mammalian sequence entries, part 224.
5179. gbmam225.seq - Other mammalian sequence entries, part 225.
5180. gbmam226.seq - Other mammalian sequence entries, part 226.
5181. gbmam227.seq - Other mammalian sequence entries, part 227.
5182. gbmam228.seq - Other mammalian sequence entries, part 228.
5183. gbmam229.seq - Other mammalian sequence entries, part 229.
5184. gbmam23.seq - Other mammalian sequence entries, part 23.
5185. gbmam230.seq - Other mammalian sequence entries, part 230.
5186. gbmam231.seq - Other mammalian sequence entries, part 231.
5187. gbmam232.seq - Other mammalian sequence entries, part 232.
5188. gbmam233.seq - Other mammalian sequence entries, part 233.
5189. gbmam234.seq - Other mammalian sequence entries, part 234.
5190. gbmam235.seq - Other mammalian sequence entries, part 235.
5191. gbmam236.seq - Other mammalian sequence entries, part 236.
5192. gbmam237.seq - Other mammalian sequence entries, part 237.
5193. gbmam238.seq - Other mammalian sequence entries, part 238.
5194. gbmam239.seq - Other mammalian sequence entries, part 239.
5195. gbmam24.seq - Other mammalian sequence entries, part 24.
5196. gbmam240.seq - Other mammalian sequence entries, part 240.
5197. gbmam241.seq - Other mammalian sequence entries, part 241.
5198. gbmam242.seq - Other mammalian sequence entries, part 242.
5199. gbmam243.seq - Other mammalian sequence entries, part 243.
5200. gbmam244.seq - Other mammalian sequence entries, part 244.
5201. gbmam245.seq - Other mammalian sequence entries, part 245.
5202. gbmam246.seq - Other mammalian sequence entries, part 246.
5203. gbmam247.seq - Other mammalian sequence entries, part 247.
5204. gbmam248.seq - Other mammalian sequence entries, part 248.
5205. gbmam249.seq - Other mammalian sequence entries, part 249.
5206. gbmam25.seq - Other mammalian sequence entries, part 25.
5207. gbmam250.seq - Other mammalian sequence entries, part 250.
5208. gbmam251.seq - Other mammalian sequence entries, part 251.
5209. gbmam252.seq - Other mammalian sequence entries, part 252.
5210. gbmam253.seq - Other mammalian sequence entries, part 253.
5211. gbmam254.seq - Other mammalian sequence entries, part 254.
5212. gbmam255.seq - Other mammalian sequence entries, part 255.
5213. gbmam256.seq - Other mammalian sequence entries, part 256.
5214. gbmam257.seq - Other mammalian sequence entries, part 257.
5215. gbmam258.seq - Other mammalian sequence entries, part 258.
5216. gbmam259.seq - Other mammalian sequence entries, part 259.
5217. gbmam26.seq - Other mammalian sequence entries, part 26.
5218. gbmam260.seq - Other mammalian sequence entries, part 260.
5219. gbmam261.seq - Other mammalian sequence entries, part 261.
5220. gbmam262.seq - Other mammalian sequence entries, part 262.
5221. gbmam263.seq - Other mammalian sequence entries, part 263.
5222. gbmam264.seq - Other mammalian sequence entries, part 264.
5223. gbmam265.seq - Other mammalian sequence entries, part 265.
5224. gbmam266.seq - Other mammalian sequence entries, part 266.
5225. gbmam267.seq - Other mammalian sequence entries, part 267.
5226. gbmam268.seq - Other mammalian sequence entries, part 268.
5227. gbmam269.seq - Other mammalian sequence entries, part 269.
5228. gbmam27.seq - Other mammalian sequence entries, part 27.
5229. gbmam270.seq - Other mammalian sequence entries, part 270.
5230. gbmam271.seq - Other mammalian sequence entries, part 271.
5231. gbmam272.seq - Other mammalian sequence entries, part 272.
5232. gbmam273.seq - Other mammalian sequence entries, part 273.
5233. gbmam274.seq - Other mammalian sequence entries, part 274.
5234. gbmam275.seq - Other mammalian sequence entries, part 275.
5235. gbmam276.seq - Other mammalian sequence entries, part 276.
5236. gbmam277.seq - Other mammalian sequence entries, part 277.
5237. gbmam278.seq - Other mammalian sequence entries, part 278.
5238. gbmam279.seq - Other mammalian sequence entries, part 279.
5239. gbmam28.seq - Other mammalian sequence entries, part 28.
5240. gbmam280.seq - Other mammalian sequence entries, part 280.
5241. gbmam281.seq - Other mammalian sequence entries, part 281.
5242. gbmam282.seq - Other mammalian sequence entries, part 282.
5243. gbmam283.seq - Other mammalian sequence entries, part 283.
5244. gbmam284.seq - Other mammalian sequence entries, part 284.
5245. gbmam285.seq - Other mammalian sequence entries, part 285.
5246. gbmam286.seq - Other mammalian sequence entries, part 286.
5247. gbmam287.seq - Other mammalian sequence entries, part 287.
5248. gbmam288.seq - Other mammalian sequence entries, part 288.
5249. gbmam289.seq - Other mammalian sequence entries, part 289.
5250. gbmam29.seq - Other mammalian sequence entries, part 29.
5251. gbmam290.seq - Other mammalian sequence entries, part 290.
5252. gbmam291.seq - Other mammalian sequence entries, part 291.
5253. gbmam292.seq - Other mammalian sequence entries, part 292.
5254. gbmam293.seq - Other mammalian sequence entries, part 293.
5255. gbmam294.seq - Other mammalian sequence entries, part 294.
5256. gbmam295.seq - Other mammalian sequence entries, part 295.
5257. gbmam296.seq - Other mammalian sequence entries, part 296.
5258. gbmam297.seq - Other mammalian sequence entries, part 297.
5259. gbmam298.seq - Other mammalian sequence entries, part 298.
5260. gbmam299.seq - Other mammalian sequence entries, part 299.
5261. gbmam3.seq - Other mammalian sequence entries, part 3.
5262. gbmam30.seq - Other mammalian sequence entries, part 30.
5263. gbmam300.seq - Other mammalian sequence entries, part 300.
5264. gbmam301.seq - Other mammalian sequence entries, part 301.
5265. gbmam302.seq - Other mammalian sequence entries, part 302.
5266. gbmam303.seq - Other mammalian sequence entries, part 303.
5267. gbmam304.seq - Other mammalian sequence entries, part 304.
5268. gbmam305.seq - Other mammalian sequence entries, part 305.
5269. gbmam306.seq - Other mammalian sequence entries, part 306.
5270. gbmam307.seq - Other mammalian sequence entries, part 307.
5271. gbmam308.seq - Other mammalian sequence entries, part 308.
5272. gbmam309.seq - Other mammalian sequence entries, part 309.
5273. gbmam31.seq - Other mammalian sequence entries, part 31.
5274. gbmam310.seq - Other mammalian sequence entries, part 310.
5275. gbmam311.seq - Other mammalian sequence entries, part 311.
5276. gbmam312.seq - Other mammalian sequence entries, part 312.
5277. gbmam313.seq - Other mammalian sequence entries, part 313.
5278. gbmam314.seq - Other mammalian sequence entries, part 314.
5279. gbmam315.seq - Other mammalian sequence entries, part 315.
5280. gbmam316.seq - Other mammalian sequence entries, part 316.
5281. gbmam317.seq - Other mammalian sequence entries, part 317.
5282. gbmam318.seq - Other mammalian sequence entries, part 318.
5283. gbmam319.seq - Other mammalian sequence entries, part 319.
5284. gbmam32.seq - Other mammalian sequence entries, part 32.
5285. gbmam320.seq - Other mammalian sequence entries, part 320.
5286. gbmam321.seq - Other mammalian sequence entries, part 321.
5287. gbmam322.seq - Other mammalian sequence entries, part 322.
5288. gbmam323.seq - Other mammalian sequence entries, part 323.
5289. gbmam324.seq - Other mammalian sequence entries, part 324.
5290. gbmam325.seq - Other mammalian sequence entries, part 325.
5291. gbmam326.seq - Other mammalian sequence entries, part 326.
5292. gbmam327.seq - Other mammalian sequence entries, part 327.
5293. gbmam328.seq - Other mammalian sequence entries, part 328.
5294. gbmam329.seq - Other mammalian sequence entries, part 329.
5295. gbmam33.seq - Other mammalian sequence entries, part 33.
5296. gbmam330.seq - Other mammalian sequence entries, part 330.
5297. gbmam331.seq - Other mammalian sequence entries, part 331.
5298. gbmam332.seq - Other mammalian sequence entries, part 332.
5299. gbmam333.seq - Other mammalian sequence entries, part 333.
5300. gbmam334.seq - Other mammalian sequence entries, part 334.
5301. gbmam335.seq - Other mammalian sequence entries, part 335.
5302. gbmam336.seq - Other mammalian sequence entries, part 336.
5303. gbmam337.seq - Other mammalian sequence entries, part 337.
5304. gbmam338.seq - Other mammalian sequence entries, part 338.
5305. gbmam339.seq - Other mammalian sequence entries, part 339.
5306. gbmam34.seq - Other mammalian sequence entries, part 34.
5307. gbmam340.seq - Other mammalian sequence entries, part 340.
5308. gbmam341.seq - Other mammalian sequence entries, part 341.
5309. gbmam342.seq - Other mammalian sequence entries, part 342.
5310. gbmam343.seq - Other mammalian sequence entries, part 343.
5311. gbmam344.seq - Other mammalian sequence entries, part 344.
5312. gbmam345.seq - Other mammalian sequence entries, part 345.
5313. gbmam346.seq - Other mammalian sequence entries, part 346.
5314. gbmam347.seq - Other mammalian sequence entries, part 347.
5315. gbmam348.seq - Other mammalian sequence entries, part 348.
5316. gbmam349.seq - Other mammalian sequence entries, part 349.
5317. gbmam35.seq - Other mammalian sequence entries, part 35.
5318. gbmam36.seq - Other mammalian sequence entries, part 36.
5319. gbmam37.seq - Other mammalian sequence entries, part 37.
5320. gbmam38.seq - Other mammalian sequence entries, part 38.
5321. gbmam39.seq - Other mammalian sequence entries, part 39.
5322. gbmam4.seq - Other mammalian sequence entries, part 4.
5323. gbmam40.seq - Other mammalian sequence entries, part 40.
5324. gbmam41.seq - Other mammalian sequence entries, part 41.
5325. gbmam42.seq - Other mammalian sequence entries, part 42.
5326. gbmam43.seq - Other mammalian sequence entries, part 43.
5327. gbmam44.seq - Other mammalian sequence entries, part 44.
5328. gbmam45.seq - Other mammalian sequence entries, part 45.
5329. gbmam46.seq - Other mammalian sequence entries, part 46.
5330. gbmam47.seq - Other mammalian sequence entries, part 47.
5331. gbmam48.seq - Other mammalian sequence entries, part 48.
5332. gbmam49.seq - Other mammalian sequence entries, part 49.
5333. gbmam5.seq - Other mammalian sequence entries, part 5.
5334. gbmam50.seq - Other mammalian sequence entries, part 50.
5335. gbmam51.seq - Other mammalian sequence entries, part 51.
5336. gbmam52.seq - Other mammalian sequence entries, part 52.
5337. gbmam53.seq - Other mammalian sequence entries, part 53.
5338. gbmam54.seq - Other mammalian sequence entries, part 54.
5339. gbmam55.seq - Other mammalian sequence entries, part 55.
5340. gbmam56.seq - Other mammalian sequence entries, part 56.
5341. gbmam57.seq - Other mammalian sequence entries, part 57.
5342. gbmam58.seq - Other mammalian sequence entries, part 58.
5343. gbmam59.seq - Other mammalian sequence entries, part 59.
5344. gbmam6.seq - Other mammalian sequence entries, part 6.
5345. gbmam60.seq - Other mammalian sequence entries, part 60.
5346. gbmam61.seq - Other mammalian sequence entries, part 61.
5347. gbmam62.seq - Other mammalian sequence entries, part 62.
5348. gbmam63.seq - Other mammalian sequence entries, part 63.
5349. gbmam64.seq - Other mammalian sequence entries, part 64.
5350. gbmam65.seq - Other mammalian sequence entries, part 65.
5351. gbmam66.seq - Other mammalian sequence entries, part 66.
5352. gbmam67.seq - Other mammalian sequence entries, part 67.
5353. gbmam68.seq - Other mammalian sequence entries, part 68.
5354. gbmam69.seq - Other mammalian sequence entries, part 69.
5355. gbmam7.seq - Other mammalian sequence entries, part 7.
5356. gbmam70.seq - Other mammalian sequence entries, part 70.
5357. gbmam71.seq - Other mammalian sequence entries, part 71.
5358. gbmam72.seq - Other mammalian sequence entries, part 72.
5359. gbmam73.seq - Other mammalian sequence entries, part 73.
5360. gbmam74.seq - Other mammalian sequence entries, part 74.
5361. gbmam75.seq - Other mammalian sequence entries, part 75.
5362. gbmam76.seq - Other mammalian sequence entries, part 76.
5363. gbmam77.seq - Other mammalian sequence entries, part 77.
5364. gbmam78.seq - Other mammalian sequence entries, part 78.
5365. gbmam79.seq - Other mammalian sequence entries, part 79.
5366. gbmam8.seq - Other mammalian sequence entries, part 8.
5367. gbmam80.seq - Other mammalian sequence entries, part 80.
5368. gbmam81.seq - Other mammalian sequence entries, part 81.
5369. gbmam82.seq - Other mammalian sequence entries, part 82.
5370. gbmam83.seq - Other mammalian sequence entries, part 83.
5371. gbmam84.seq - Other mammalian sequence entries, part 84.
5372. gbmam85.seq - Other mammalian sequence entries, part 85.
5373. gbmam86.seq - Other mammalian sequence entries, part 86.
5374. gbmam87.seq - Other mammalian sequence entries, part 87.
5375. gbmam88.seq - Other mammalian sequence entries, part 88.
5376. gbmam89.seq - Other mammalian sequence entries, part 89.
5377. gbmam9.seq - Other mammalian sequence entries, part 9.
5378. gbmam90.seq - Other mammalian sequence entries, part 90.
5379. gbmam91.seq - Other mammalian sequence entries, part 91.
5380. gbmam92.seq - Other mammalian sequence entries, part 92.
5381. gbmam93.seq - Other mammalian sequence entries, part 93.
5382. gbmam94.seq - Other mammalian sequence entries, part 94.
5383. gbmam95.seq - Other mammalian sequence entries, part 95.
5384. gbmam96.seq - Other mammalian sequence entries, part 96.
5385. gbmam97.seq - Other mammalian sequence entries, part 97.
5386. gbmam98.seq - Other mammalian sequence entries, part 98.
5387. gbmam99.seq - Other mammalian sequence entries, part 99.
5388. gbnew.txt - Accession numbers of entries new since the previous release.
5389. gbpat1.seq - Patent sequence entries, part 1.
5390. gbpat10.seq - Patent sequence entries, part 10.
5391. gbpat100.seq - Patent sequence entries, part 100.
5392. gbpat101.seq - Patent sequence entries, part 101.
5393. gbpat102.seq - Patent sequence entries, part 102.
5394. gbpat103.seq - Patent sequence entries, part 103.
5395. gbpat104.seq - Patent sequence entries, part 104.
5396. gbpat105.seq - Patent sequence entries, part 105.
5397. gbpat106.seq - Patent sequence entries, part 106.
5398. gbpat107.seq - Patent sequence entries, part 107.
5399. gbpat108.seq - Patent sequence entries, part 108.
5400. gbpat109.seq - Patent sequence entries, part 109.
5401. gbpat11.seq - Patent sequence entries, part 11.
5402. gbpat110.seq - Patent sequence entries, part 110.
5403. gbpat111.seq - Patent sequence entries, part 111.
5404. gbpat112.seq - Patent sequence entries, part 112.
5405. gbpat113.seq - Patent sequence entries, part 113.
5406. gbpat114.seq - Patent sequence entries, part 114.
5407. gbpat115.seq - Patent sequence entries, part 115.
5408. gbpat116.seq - Patent sequence entries, part 116.
5409. gbpat117.seq - Patent sequence entries, part 117.
5410. gbpat118.seq - Patent sequence entries, part 118.
5411. gbpat119.seq - Patent sequence entries, part 119.
5412. gbpat12.seq - Patent sequence entries, part 12.
5413. gbpat120.seq - Patent sequence entries, part 120.
5414. gbpat121.seq - Patent sequence entries, part 121.
5415. gbpat122.seq - Patent sequence entries, part 122.
5416. gbpat123.seq - Patent sequence entries, part 123.
5417. gbpat124.seq - Patent sequence entries, part 124.
5418. gbpat125.seq - Patent sequence entries, part 125.
5419. gbpat126.seq - Patent sequence entries, part 126.
5420. gbpat127.seq - Patent sequence entries, part 127.
5421. gbpat128.seq - Patent sequence entries, part 128.
5422. gbpat129.seq - Patent sequence entries, part 129.
5423. gbpat13.seq - Patent sequence entries, part 13.
5424. gbpat130.seq - Patent sequence entries, part 130.
5425. gbpat131.seq - Patent sequence entries, part 131.
5426. gbpat132.seq - Patent sequence entries, part 132.
5427. gbpat133.seq - Patent sequence entries, part 133.
5428. gbpat134.seq - Patent sequence entries, part 134.
5429. gbpat135.seq - Patent sequence entries, part 135.
5430. gbpat136.seq - Patent sequence entries, part 136.
5431. gbpat137.seq - Patent sequence entries, part 137.
5432. gbpat138.seq - Patent sequence entries, part 138.
5433. gbpat139.seq - Patent sequence entries, part 139.
5434. gbpat14.seq - Patent sequence entries, part 14.
5435. gbpat140.seq - Patent sequence entries, part 140.
5436. gbpat141.seq - Patent sequence entries, part 141.
5437. gbpat142.seq - Patent sequence entries, part 142.
5438. gbpat143.seq - Patent sequence entries, part 143.
5439. gbpat144.seq - Patent sequence entries, part 144.
5440. gbpat145.seq - Patent sequence entries, part 145.
5441. gbpat146.seq - Patent sequence entries, part 146.
5442. gbpat147.seq - Patent sequence entries, part 147.
5443. gbpat148.seq - Patent sequence entries, part 148.
5444. gbpat149.seq - Patent sequence entries, part 149.
5445. gbpat15.seq - Patent sequence entries, part 15.
5446. gbpat150.seq - Patent sequence entries, part 150.
5447. gbpat151.seq - Patent sequence entries, part 151.
5448. gbpat152.seq - Patent sequence entries, part 152.
5449. gbpat153.seq - Patent sequence entries, part 153.
5450. gbpat154.seq - Patent sequence entries, part 154.
5451. gbpat155.seq - Patent sequence entries, part 155.
5452. gbpat156.seq - Patent sequence entries, part 156.
5453. gbpat157.seq - Patent sequence entries, part 157.
5454. gbpat158.seq - Patent sequence entries, part 158.
5455. gbpat159.seq - Patent sequence entries, part 159.
5456. gbpat16.seq - Patent sequence entries, part 16.
5457. gbpat160.seq - Patent sequence entries, part 160.
5458. gbpat161.seq - Patent sequence entries, part 161.
5459. gbpat162.seq - Patent sequence entries, part 162.
5460. gbpat163.seq - Patent sequence entries, part 163.
5461. gbpat164.seq - Patent sequence entries, part 164.
5462. gbpat165.seq - Patent sequence entries, part 165.
5463. gbpat166.seq - Patent sequence entries, part 166.
5464. gbpat167.seq - Patent sequence entries, part 167.
5465. gbpat168.seq - Patent sequence entries, part 168.
5466. gbpat169.seq - Patent sequence entries, part 169.
5467. gbpat17.seq - Patent sequence entries, part 17.
5468. gbpat170.seq - Patent sequence entries, part 170.
5469. gbpat171.seq - Patent sequence entries, part 171.
5470. gbpat172.seq - Patent sequence entries, part 172.
5471. gbpat173.seq - Patent sequence entries, part 173.
5472. gbpat174.seq - Patent sequence entries, part 174.
5473. gbpat175.seq - Patent sequence entries, part 175.
5474. gbpat176.seq - Patent sequence entries, part 176.
5475. gbpat177.seq - Patent sequence entries, part 177.
5476. gbpat178.seq - Patent sequence entries, part 178.
5477. gbpat179.seq - Patent sequence entries, part 179.
5478. gbpat18.seq - Patent sequence entries, part 18.
5479. gbpat180.seq - Patent sequence entries, part 180.
5480. gbpat181.seq - Patent sequence entries, part 181.
5481. gbpat182.seq - Patent sequence entries, part 182.
5482. gbpat183.seq - Patent sequence entries, part 183.
5483. gbpat184.seq - Patent sequence entries, part 184.
5484. gbpat185.seq - Patent sequence entries, part 185.
5485. gbpat186.seq - Patent sequence entries, part 186.
5486. gbpat187.seq - Patent sequence entries, part 187.
5487. gbpat188.seq - Patent sequence entries, part 188.
5488. gbpat189.seq - Patent sequence entries, part 189.
5489. gbpat19.seq - Patent sequence entries, part 19.
5490. gbpat190.seq - Patent sequence entries, part 190.
5491. gbpat191.seq - Patent sequence entries, part 191.
5492. gbpat192.seq - Patent sequence entries, part 192.
5493. gbpat193.seq - Patent sequence entries, part 193.
5494. gbpat194.seq - Patent sequence entries, part 194.
5495. gbpat195.seq - Patent sequence entries, part 195.
5496. gbpat196.seq - Patent sequence entries, part 196.
5497. gbpat197.seq - Patent sequence entries, part 197.
5498. gbpat198.seq - Patent sequence entries, part 198.
5499. gbpat199.seq - Patent sequence entries, part 199.
5500. gbpat2.seq - Patent sequence entries, part 2.
5501. gbpat20.seq - Patent sequence entries, part 20.
5502. gbpat200.seq - Patent sequence entries, part 200.
5503. gbpat201.seq - Patent sequence entries, part 201.
5504. gbpat202.seq - Patent sequence entries, part 202.
5505. gbpat203.seq - Patent sequence entries, part 203.
5506. gbpat204.seq - Patent sequence entries, part 204.
5507. gbpat205.seq - Patent sequence entries, part 205.
5508. gbpat206.seq - Patent sequence entries, part 206.
5509. gbpat207.seq - Patent sequence entries, part 207.
5510. gbpat208.seq - Patent sequence entries, part 208.
5511. gbpat209.seq - Patent sequence entries, part 209.
5512. gbpat21.seq - Patent sequence entries, part 21.
5513. gbpat210.seq - Patent sequence entries, part 210.
5514. gbpat211.seq - Patent sequence entries, part 211.
5515. gbpat212.seq - Patent sequence entries, part 212.
5516. gbpat213.seq - Patent sequence entries, part 213.
5517. gbpat214.seq - Patent sequence entries, part 214.
5518. gbpat215.seq - Patent sequence entries, part 215.
5519. gbpat216.seq - Patent sequence entries, part 216.
5520. gbpat217.seq - Patent sequence entries, part 217.
5521. gbpat218.seq - Patent sequence entries, part 218.
5522. gbpat219.seq - Patent sequence entries, part 219.
5523. gbpat22.seq - Patent sequence entries, part 22.
5524. gbpat220.seq - Patent sequence entries, part 220.
5525. gbpat221.seq - Patent sequence entries, part 221.
5526. gbpat222.seq - Patent sequence entries, part 222.
5527. gbpat223.seq - Patent sequence entries, part 223.
5528. gbpat224.seq - Patent sequence entries, part 224.
5529. gbpat225.seq - Patent sequence entries, part 225.
5530. gbpat226.seq - Patent sequence entries, part 226.
5531. gbpat227.seq - Patent sequence entries, part 227.
5532. gbpat228.seq - Patent sequence entries, part 228.
5533. gbpat229.seq - Patent sequence entries, part 229.
5534. gbpat23.seq - Patent sequence entries, part 23.
5535. gbpat230.seq - Patent sequence entries, part 230.
5536. gbpat231.seq - Patent sequence entries, part 231.
5537. gbpat232.seq - Patent sequence entries, part 232.
5538. gbpat233.seq - Patent sequence entries, part 233.
5539. gbpat234.seq - Patent sequence entries, part 234.
5540. gbpat235.seq - Patent sequence entries, part 235.
5541. gbpat236.seq - Patent sequence entries, part 236.
5542. gbpat237.seq - Patent sequence entries, part 237.
5543. gbpat238.seq - Patent sequence entries, part 238.
5544. gbpat239.seq - Patent sequence entries, part 239.
5545. gbpat24.seq - Patent sequence entries, part 24.
5546. gbpat240.seq - Patent sequence entries, part 240.
5547. gbpat241.seq - Patent sequence entries, part 241.
5548. gbpat242.seq - Patent sequence entries, part 242.
5549. gbpat243.seq - Patent sequence entries, part 243.
5550. gbpat244.seq - Patent sequence entries, part 244.
5551. gbpat245.seq - Patent sequence entries, part 245.
5552. gbpat246.seq - Patent sequence entries, part 246.
5553. gbpat247.seq - Patent sequence entries, part 247.
5554. gbpat248.seq - Patent sequence entries, part 248.
5555. gbpat249.seq - Patent sequence entries, part 249.
5556. gbpat25.seq - Patent sequence entries, part 25.
5557. gbpat250.seq - Patent sequence entries, part 250.
5558. gbpat251.seq - Patent sequence entries, part 251.
5559. gbpat252.seq - Patent sequence entries, part 252.
5560. gbpat253.seq - Patent sequence entries, part 253.
5561. gbpat254.seq - Patent sequence entries, part 254.
5562. gbpat255.seq - Patent sequence entries, part 255.
5563. gbpat256.seq - Patent sequence entries, part 256.
5564. gbpat257.seq - Patent sequence entries, part 257.
5565. gbpat258.seq - Patent sequence entries, part 258.
5566. gbpat259.seq - Patent sequence entries, part 259.
5567. gbpat26.seq - Patent sequence entries, part 26.
5568. gbpat260.seq - Patent sequence entries, part 260.
5569. gbpat261.seq - Patent sequence entries, part 261.
5570. gbpat262.seq - Patent sequence entries, part 262.
5571. gbpat263.seq - Patent sequence entries, part 263.
5572. gbpat264.seq - Patent sequence entries, part 264.
5573. gbpat265.seq - Patent sequence entries, part 265.
5574. gbpat266.seq - Patent sequence entries, part 266.
5575. gbpat267.seq - Patent sequence entries, part 267.
5576. gbpat268.seq - Patent sequence entries, part 268.
5577. gbpat269.seq - Patent sequence entries, part 269.
5578. gbpat27.seq - Patent sequence entries, part 27.
5579. gbpat28.seq - Patent sequence entries, part 28.
5580. gbpat29.seq - Patent sequence entries, part 29.
5581. gbpat3.seq - Patent sequence entries, part 3.
5582. gbpat30.seq - Patent sequence entries, part 30.
5583. gbpat31.seq - Patent sequence entries, part 31.
5584. gbpat32.seq - Patent sequence entries, part 32.
5585. gbpat33.seq - Patent sequence entries, part 33.
5586. gbpat34.seq - Patent sequence entries, part 34.
5587. gbpat35.seq - Patent sequence entries, part 35.
5588. gbpat36.seq - Patent sequence entries, part 36.
5589. gbpat37.seq - Patent sequence entries, part 37.
5590. gbpat38.seq - Patent sequence entries, part 38.
5591. gbpat39.seq - Patent sequence entries, part 39.
5592. gbpat4.seq - Patent sequence entries, part 4.
5593. gbpat40.seq - Patent sequence entries, part 40.
5594. gbpat41.seq - Patent sequence entries, part 41.
5595. gbpat42.seq - Patent sequence entries, part 42.
5596. gbpat43.seq - Patent sequence entries, part 43.
5597. gbpat44.seq - Patent sequence entries, part 44.
5598. gbpat45.seq - Patent sequence entries, part 45.
5599. gbpat46.seq - Patent sequence entries, part 46.
5600. gbpat47.seq - Patent sequence entries, part 47.
5601. gbpat48.seq - Patent sequence entries, part 48.
5602. gbpat49.seq - Patent sequence entries, part 49.
5603. gbpat5.seq - Patent sequence entries, part 5.
5604. gbpat50.seq - Patent sequence entries, part 50.
5605. gbpat51.seq - Patent sequence entries, part 51.
5606. gbpat52.seq - Patent sequence entries, part 52.
5607. gbpat53.seq - Patent sequence entries, part 53.
5608. gbpat54.seq - Patent sequence entries, part 54.
5609. gbpat55.seq - Patent sequence entries, part 55.
5610. gbpat56.seq - Patent sequence entries, part 56.
5611. gbpat57.seq - Patent sequence entries, part 57.
5612. gbpat58.seq - Patent sequence entries, part 58.
5613. gbpat59.seq - Patent sequence entries, part 59.
5614. gbpat6.seq - Patent sequence entries, part 6.
5615. gbpat60.seq - Patent sequence entries, part 60.
5616. gbpat61.seq - Patent sequence entries, part 61.
5617. gbpat62.seq - Patent sequence entries, part 62.
5618. gbpat63.seq - Patent sequence entries, part 63.
5619. gbpat64.seq - Patent sequence entries, part 64.
5620. gbpat65.seq - Patent sequence entries, part 65.
5621. gbpat66.seq - Patent sequence entries, part 66.
5622. gbpat67.seq - Patent sequence entries, part 67.
5623. gbpat68.seq - Patent sequence entries, part 68.
5624. gbpat69.seq - Patent sequence entries, part 69.
5625. gbpat7.seq - Patent sequence entries, part 7.
5626. gbpat70.seq - Patent sequence entries, part 70.
5627. gbpat71.seq - Patent sequence entries, part 71.
5628. gbpat72.seq - Patent sequence entries, part 72.
5629. gbpat73.seq - Patent sequence entries, part 73.
5630. gbpat74.seq - Patent sequence entries, part 74.
5631. gbpat75.seq - Patent sequence entries, part 75.
5632. gbpat76.seq - Patent sequence entries, part 76.
5633. gbpat77.seq - Patent sequence entries, part 77.
5634. gbpat78.seq - Patent sequence entries, part 78.
5635. gbpat79.seq - Patent sequence entries, part 79.
5636. gbpat8.seq - Patent sequence entries, part 8.
5637. gbpat80.seq - Patent sequence entries, part 80.
5638. gbpat81.seq - Patent sequence entries, part 81.
5639. gbpat82.seq - Patent sequence entries, part 82.
5640. gbpat83.seq - Patent sequence entries, part 83.
5641. gbpat84.seq - Patent sequence entries, part 84.
5642. gbpat85.seq - Patent sequence entries, part 85.
5643. gbpat86.seq - Patent sequence entries, part 86.
5644. gbpat87.seq - Patent sequence entries, part 87.
5645. gbpat88.seq - Patent sequence entries, part 88.
5646. gbpat89.seq - Patent sequence entries, part 89.
5647. gbpat9.seq - Patent sequence entries, part 9.
5648. gbpat90.seq - Patent sequence entries, part 90.
5649. gbpat91.seq - Patent sequence entries, part 91.
5650. gbpat92.seq - Patent sequence entries, part 92.
5651. gbpat93.seq - Patent sequence entries, part 93.
5652. gbpat94.seq - Patent sequence entries, part 94.
5653. gbpat95.seq - Patent sequence entries, part 95.
5654. gbpat96.seq - Patent sequence entries, part 96.
5655. gbpat97.seq - Patent sequence entries, part 97.
5656. gbpat98.seq - Patent sequence entries, part 98.
5657. gbpat99.seq - Patent sequence entries, part 99.
5658. gbphg1.seq - Phage sequence entries, part 1.
5659. gbphg2.seq - Phage sequence entries, part 2.
5660. gbphg3.seq - Phage sequence entries, part 3.
5661. gbphg4.seq - Phage sequence entries, part 4.
5662. gbphg5.seq - Phage sequence entries, part 5.
5663. gbphg6.seq - Phage sequence entries, part 6.
5664. gbphg7.seq - Phage sequence entries, part 7.
5665. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
5666. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
5667. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
5668. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
5669. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
5670. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
5671. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
5672. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
5673. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
5674. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
5675. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
5676. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
5677. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
5678. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
5679. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
5680. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
5681. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
5682. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
5683. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
5684. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
5685. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
5686. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
5687. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
5688. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
5689. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
5690. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
5691. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
5692. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
5693. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
5694. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
5695. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
5696. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
5697. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
5698. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
5699. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
5700. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
5701. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
5702. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
5703. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
5704. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
5705. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
5706. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
5707. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
5708. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
5709. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
5710. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
5711. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
5712. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
5713. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
5714. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
5715. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
5716. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
5717. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
5718. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
5719. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
5720. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
5721. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
5722. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
5723. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
5724. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
5725. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
5726. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
5727. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
5728. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
5729. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
5730. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
5731. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
5732. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
5733. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
5734. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
5735. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
5736. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
5737. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
5738. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
5739. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
5740. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
5741. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
5742. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
5743. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
5744. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
5745. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
5746. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
5747. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
5748. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
5749. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
5750. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
5751. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
5752. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
5753. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
5754. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
5755. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
5756. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
5757. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
5758. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
5759. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
5760. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
5761. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
5762. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
5763. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
5764. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
5765. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
5766. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
5767. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
5768. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
5769. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
5770. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
5771. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
5772. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
5773. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
5774. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
5775. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
5776. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
5777. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
5778. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
5779. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
5780. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
5781. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
5782. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
5783. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
5784. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
5785. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
5786. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
5787. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
5788. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
5789. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
5790. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
5791. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
5792. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
5793. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
5794. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
5795. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
5796. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
5797. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
5798. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
5799. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
5800. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
5801. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
5802. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
5803. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
5804. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
5805. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
5806. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
5807. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
5808. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
5809. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
5810. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
5811. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
5812. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
5813. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
5814. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
5815. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
5816. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
5817. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
5818. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
5819. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
5820. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
5821. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
5822. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
5823. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
5824. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
5825. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
5826. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
5827. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
5828. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
5829. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
5830. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
5831. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
5832. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
5833. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
5834. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
5835. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
5836. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
5837. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
5838. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
5839. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
5840. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
5841. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
5842. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
5843. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
5844. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
5845. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
5846. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
5847. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
5848. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
5849. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
5850. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
5851. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
5852. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
5853. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
5854. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
5855. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
5856. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
5857. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
5858. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
5859. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
5860. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
5861. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
5862. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
5863. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
5864. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
5865. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
5866. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
5867. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
5868. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
5869. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
5870. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
5871. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
5872. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
5873. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
5874. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
5875. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
5876. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
5877. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
5878. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
5879. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
5880. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
5881. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
5882. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
5883. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
5884. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
5885. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
5886. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
5887. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
5888. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
5889. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
5890. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
5891. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
5892. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
5893. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
5894. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
5895. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
5896. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
5897. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
5898. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
5899. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
5900. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
5901. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
5902. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
5903. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
5904. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
5905. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
5906. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
5907. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
5908. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
5909. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
5910. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
5911. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
5912. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
5913. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
5914. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
5915. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
5916. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
5917. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
5918. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
5919. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
5920. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
5921. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
5922. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
5923. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
5924. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
5925. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
5926. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
5927. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
5928. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
5929. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
5930. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
5931. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
5932. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
5933. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
5934. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
5935. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
5936. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
5937. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
5938. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
5939. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
5940. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
5941. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
5942. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
5943. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
5944. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
5945. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
5946. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
5947. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
5948. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
5949. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
5950. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
5951. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
5952. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
5953. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
5954. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
5955. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
5956. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
5957. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
5958. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
5959. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
5960. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
5961. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
5962. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
5963. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
5964. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
5965. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
5966. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
5967. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
5968. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
5969. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
5970. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
5971. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
5972. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
5973. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
5974. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
5975. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
5976. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
5977. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
5978. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
5979. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
5980. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
5981. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
5982. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
5983. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
5984. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
5985. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
5986. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
5987. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
5988. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
5989. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
5990. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
5991. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
5992. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
5993. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
5994. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
5995. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
5996. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
5997. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
5998. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
5999. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
6000. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
6001. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
6002. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
6003. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
6004. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
6005. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
6006. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
6007. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
6008. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
6009. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
6010. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
6011. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
6012. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
6013. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
6014. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
6015. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
6016. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
6017. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
6018. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
6019. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
6020. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
6021. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
6022. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
6023. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
6024. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
6025. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
6026. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
6027. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
6028. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
6029. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
6030. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
6031. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
6032. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
6033. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
6034. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
6035. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
6036. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
6037. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
6038. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
6039. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
6040. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
6041. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
6042. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
6043. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
6044. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
6045. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
6046. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
6047. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
6048. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
6049. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
6050. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
6051. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
6052. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
6053. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
6054. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
6055. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
6056. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
6057. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
6058. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
6059. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
6060. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
6061. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
6062. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
6063. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
6064. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
6065. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
6066. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
6067. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
6068. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
6069. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
6070. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
6071. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
6072. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
6073. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
6074. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
6075. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
6076. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
6077. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
6078. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
6079. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
6080. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
6081. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
6082. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
6083. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
6084. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
6085. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
6086. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
6087. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
6088. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
6089. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
6090. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
6091. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
6092. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
6093. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
6094. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
6095. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
6096. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
6097. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
6098. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
6099. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
6100. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
6101. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
6102. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
6103. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
6104. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
6105. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
6106. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
6107. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
6108. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
6109. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
6110. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
6111. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
6112. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
6113. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
6114. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
6115. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
6116. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
6117. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
6118. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
6119. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
6120. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
6121. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
6122. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
6123. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
6124. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
6125. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
6126. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
6127. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
6128. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
6129. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
6130. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
6131. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
6132. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
6133. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
6134. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
6135. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
6136. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
6137. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
6138. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
6139. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
6140. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
6141. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
6142. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
6143. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
6144. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
6145. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
6146. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
6147. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
6148. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
6149. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
6150. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
6151. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
6152. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
6153. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
6154. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
6155. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
6156. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
6157. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
6158. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
6159. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
6160. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
6161. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
6162. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
6163. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
6164. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
6165. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
6166. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
6167. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
6168. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
6169. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
6170. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
6171. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
6172. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
6173. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
6174. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
6175. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
6176. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
6177. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
6178. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
6179. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
6180. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
6181. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
6182. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
6183. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
6184. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
6185. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
6186. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
6187. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
6188. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
6189. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
6190. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
6191. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
6192. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
6193. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
6194. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
6195. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
6196. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
6197. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
6198. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
6199. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
6200. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
6201. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
6202. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
6203. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
6204. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
6205. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
6206. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
6207. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
6208. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
6209. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
6210. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
6211. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
6212. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
6213. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
6214. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
6215. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
6216. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
6217. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
6218. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
6219. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
6220. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
6221. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
6222. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
6223. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
6224. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
6225. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
6226. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
6227. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
6228. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
6229. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
6230. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
6231. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
6232. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
6233. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
6234. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
6235. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
6236. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
6237. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
6238. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
6239. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
6240. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
6241. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
6242. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
6243. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
6244. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
6245. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
6246. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
6247. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
6248. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
6249. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
6250. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
6251. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
6252. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
6253. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
6254. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
6255. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
6256. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
6257. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
6258. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
6259. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
6260. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
6261. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
6262. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
6263. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
6264. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
6265. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
6266. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
6267. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
6268. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
6269. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
6270. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
6271. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
6272. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
6273. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
6274. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
6275. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
6276. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
6277. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
6278. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
6279. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
6280. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
6281. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
6282. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
6283. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
6284. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
6285. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
6286. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
6287. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
6288. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
6289. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
6290. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
6291. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
6292. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
6293. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
6294. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
6295. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
6296. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
6297. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
6298. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
6299. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
6300. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
6301. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
6302. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
6303. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
6304. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
6305. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
6306. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
6307. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
6308. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
6309. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
6310. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
6311. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
6312. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
6313. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
6314. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
6315. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
6316. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
6317. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
6318. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
6319. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
6320. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
6321. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
6322. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
6323. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
6324. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
6325. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
6326. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
6327. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
6328. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
6329. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
6330. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
6331. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
6332. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
6333. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
6334. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
6335. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
6336. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
6337. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
6338. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
6339. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
6340. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
6341. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
6342. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
6343. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
6344. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
6345. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
6346. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
6347. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
6348. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
6349. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
6350. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
6351. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
6352. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
6353. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
6354. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
6355. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
6356. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
6357. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
6358. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
6359. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
6360. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
6361. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
6362. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
6363. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
6364. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
6365. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
6366. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
6367. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
6368. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
6369. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
6370. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
6371. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
6372. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
6373. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
6374. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
6375. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
6376. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
6377. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
6378. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
6379. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
6380. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
6381. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
6382. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
6383. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
6384. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
6385. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
6386. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
6387. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
6388. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
6389. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
6390. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
6391. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
6392. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
6393. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
6394. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
6395. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
6396. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
6397. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
6398. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
6399. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
6400. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
6401. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
6402. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
6403. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
6404. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
6405. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
6406. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
6407. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
6408. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
6409. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
6410. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
6411. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
6412. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
6413. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
6414. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
6415. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
6416. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
6417. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
6418. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
6419. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
6420. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
6421. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
6422. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
6423. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
6424. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
6425. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
6426. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
6427. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
6428. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
6429. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
6430. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
6431. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
6432. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
6433. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
6434. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
6435. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
6436. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
6437. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
6438. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
6439. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
6440. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
6441. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
6442. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
6443. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
6444. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
6445. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
6446. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
6447. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
6448. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
6449. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
6450. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
6451. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
6452. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
6453. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
6454. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
6455. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
6456. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
6457. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
6458. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
6459. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
6460. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
6461. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
6462. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
6463. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
6464. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
6465. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
6466. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
6467. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
6468. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
6469. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
6470. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
6471. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
6472. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
6473. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
6474. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
6475. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
6476. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
6477. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
6478. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
6479. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
6480. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
6481. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
6482. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
6483. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
6484. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
6485. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
6486. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
6487. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
6488. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
6489. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
6490. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
6491. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
6492. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
6493. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
6494. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
6495. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
6496. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
6497. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
6498. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
6499. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
6500. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
6501. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
6502. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
6503. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
6504. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
6505. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
6506. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
6507. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
6508. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
6509. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
6510. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
6511. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
6512. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
6513. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
6514. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
6515. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
6516. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
6517. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
6518. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
6519. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
6520. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
6521. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
6522. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
6523. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
6524. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
6525. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
6526. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
6527. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
6528. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
6529. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
6530. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
6531. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
6532. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
6533. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
6534. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
6535. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
6536. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
6537. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
6538. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
6539. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
6540. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
6541. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
6542. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
6543. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
6544. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
6545. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
6546. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
6547. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
6548. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
6549. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
6550. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
6551. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
6552. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
6553. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
6554. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
6555. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
6556. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
6557. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
6558. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
6559. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
6560. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
6561. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
6562. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
6563. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807.
6564. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808.
6565. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809.
6566. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
6567. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810.
6568. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811.
6569. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812.
6570. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813.
6571. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814.
6572. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815.
6573. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816.
6574. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817.
6575. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818.
6576. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819.
6577. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
6578. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820.
6579. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821.
6580. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822.
6581. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823.
6582. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824.
6583. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825.
6584. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826.
6585. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827.
6586. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828.
6587. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829.
6588. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
6589. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830.
6590. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831.
6591. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832.
6592. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833.
6593. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834.
6594. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835.
6595. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836.
6596. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837.
6597. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838.
6598. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839.
6599. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
6600. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840.
6601. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841.
6602. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842.
6603. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843.
6604. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844.
6605. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845.
6606. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846.
6607. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847.
6608. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848.
6609. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849.
6610. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
6611. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850.
6612. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851.
6613. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852.
6614. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853.
6615. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854.
6616. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855.
6617. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856.
6618. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857.
6619. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858.
6620. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859.
6621. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
6622. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860.
6623. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861.
6624. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862.
6625. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863.
6626. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864.
6627. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865.
6628. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866.
6629. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867.
6630. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868.
6631. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869.
6632. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
6633. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870.
6634. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871.
6635. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872.
6636. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873.
6637. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874.
6638. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875.
6639. gbpln1876.seq - Plant sequence entries (including fungi and algae), part 1876.
6640. gbpln1877.seq - Plant sequence entries (including fungi and algae), part 1877.
6641. gbpln1878.seq - Plant sequence entries (including fungi and algae), part 1878.
6642. gbpln1879.seq - Plant sequence entries (including fungi and algae), part 1879.
6643. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
6644. gbpln1880.seq - Plant sequence entries (including fungi and algae), part 1880.
6645. gbpln1881.seq - Plant sequence entries (including fungi and algae), part 1881.
6646. gbpln1882.seq - Plant sequence entries (including fungi and algae), part 1882.
6647. gbpln1883.seq - Plant sequence entries (including fungi and algae), part 1883.
6648. gbpln1884.seq - Plant sequence entries (including fungi and algae), part 1884.
6649. gbpln1885.seq - Plant sequence entries (including fungi and algae), part 1885.
6650. gbpln1886.seq - Plant sequence entries (including fungi and algae), part 1886.
6651. gbpln1887.seq - Plant sequence entries (including fungi and algae), part 1887.
6652. gbpln1888.seq - Plant sequence entries (including fungi and algae), part 1888.
6653. gbpln1889.seq - Plant sequence entries (including fungi and algae), part 1889.
6654. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
6655. gbpln1890.seq - Plant sequence entries (including fungi and algae), part 1890.
6656. gbpln1891.seq - Plant sequence entries (including fungi and algae), part 1891.
6657. gbpln1892.seq - Plant sequence entries (including fungi and algae), part 1892.
6658. gbpln1893.seq - Plant sequence entries (including fungi and algae), part 1893.
6659. gbpln1894.seq - Plant sequence entries (including fungi and algae), part 1894.
6660. gbpln1895.seq - Plant sequence entries (including fungi and algae), part 1895.
6661. gbpln1896.seq - Plant sequence entries (including fungi and algae), part 1896.
6662. gbpln1897.seq - Plant sequence entries (including fungi and algae), part 1897.
6663. gbpln1898.seq - Plant sequence entries (including fungi and algae), part 1898.
6664. gbpln1899.seq - Plant sequence entries (including fungi and algae), part 1899.
6665. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
6666. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
6667. gbpln1900.seq - Plant sequence entries (including fungi and algae), part 1900.
6668. gbpln1901.seq - Plant sequence entries (including fungi and algae), part 1901.
6669. gbpln1902.seq - Plant sequence entries (including fungi and algae), part 1902.
6670. gbpln1903.seq - Plant sequence entries (including fungi and algae), part 1903.
6671. gbpln1904.seq - Plant sequence entries (including fungi and algae), part 1904.
6672. gbpln1905.seq - Plant sequence entries (including fungi and algae), part 1905.
6673. gbpln1906.seq - Plant sequence entries (including fungi and algae), part 1906.
6674. gbpln1907.seq - Plant sequence entries (including fungi and algae), part 1907.
6675. gbpln1908.seq - Plant sequence entries (including fungi and algae), part 1908.
6676. gbpln1909.seq - Plant sequence entries (including fungi and algae), part 1909.
6677. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
6678. gbpln1910.seq - Plant sequence entries (including fungi and algae), part 1910.
6679. gbpln1911.seq - Plant sequence entries (including fungi and algae), part 1911.
6680. gbpln1912.seq - Plant sequence entries (including fungi and algae), part 1912.
6681. gbpln1913.seq - Plant sequence entries (including fungi and algae), part 1913.
6682. gbpln1914.seq - Plant sequence entries (including fungi and algae), part 1914.
6683. gbpln1915.seq - Plant sequence entries (including fungi and algae), part 1915.
6684. gbpln1916.seq - Plant sequence entries (including fungi and algae), part 1916.
6685. gbpln1917.seq - Plant sequence entries (including fungi and algae), part 1917.
6686. gbpln1918.seq - Plant sequence entries (including fungi and algae), part 1918.
6687. gbpln1919.seq - Plant sequence entries (including fungi and algae), part 1919.
6688. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
6689. gbpln1920.seq - Plant sequence entries (including fungi and algae), part 1920.
6690. gbpln1921.seq - Plant sequence entries (including fungi and algae), part 1921.
6691. gbpln1922.seq - Plant sequence entries (including fungi and algae), part 1922.
6692. gbpln1923.seq - Plant sequence entries (including fungi and algae), part 1923.
6693. gbpln1924.seq - Plant sequence entries (including fungi and algae), part 1924.
6694. gbpln1925.seq - Plant sequence entries (including fungi and algae), part 1925.
6695. gbpln1926.seq - Plant sequence entries (including fungi and algae), part 1926.
6696. gbpln1927.seq - Plant sequence entries (including fungi and algae), part 1927.
6697. gbpln1928.seq - Plant sequence entries (including fungi and algae), part 1928.
6698. gbpln1929.seq - Plant sequence entries (including fungi and algae), part 1929.
6699. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
6700. gbpln1930.seq - Plant sequence entries (including fungi and algae), part 1930.
6701. gbpln1931.seq - Plant sequence entries (including fungi and algae), part 1931.
6702. gbpln1932.seq - Plant sequence entries (including fungi and algae), part 1932.
6703. gbpln1933.seq - Plant sequence entries (including fungi and algae), part 1933.
6704. gbpln1934.seq - Plant sequence entries (including fungi and algae), part 1934.
6705. gbpln1935.seq - Plant sequence entries (including fungi and algae), part 1935.
6706. gbpln1936.seq - Plant sequence entries (including fungi and algae), part 1936.
6707. gbpln1937.seq - Plant sequence entries (including fungi and algae), part 1937.
6708. gbpln1938.seq - Plant sequence entries (including fungi and algae), part 1938.
6709. gbpln1939.seq - Plant sequence entries (including fungi and algae), part 1939.
6710. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
6711. gbpln1940.seq - Plant sequence entries (including fungi and algae), part 1940.
6712. gbpln1941.seq - Plant sequence entries (including fungi and algae), part 1941.
6713. gbpln1942.seq - Plant sequence entries (including fungi and algae), part 1942.
6714. gbpln1943.seq - Plant sequence entries (including fungi and algae), part 1943.
6715. gbpln1944.seq - Plant sequence entries (including fungi and algae), part 1944.
6716. gbpln1945.seq - Plant sequence entries (including fungi and algae), part 1945.
6717. gbpln1946.seq - Plant sequence entries (including fungi and algae), part 1946.
6718. gbpln1947.seq - Plant sequence entries (including fungi and algae), part 1947.
6719. gbpln1948.seq - Plant sequence entries (including fungi and algae), part 1948.
6720. gbpln1949.seq - Plant sequence entries (including fungi and algae), part 1949.
6721. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
6722. gbpln1950.seq - Plant sequence entries (including fungi and algae), part 1950.
6723. gbpln1951.seq - Plant sequence entries (including fungi and algae), part 1951.
6724. gbpln1952.seq - Plant sequence entries (including fungi and algae), part 1952.
6725. gbpln1953.seq - Plant sequence entries (including fungi and algae), part 1953.
6726. gbpln1954.seq - Plant sequence entries (including fungi and algae), part 1954.
6727. gbpln1955.seq - Plant sequence entries (including fungi and algae), part 1955.
6728. gbpln1956.seq - Plant sequence entries (including fungi and algae), part 1956.
6729. gbpln1957.seq - Plant sequence entries (including fungi and algae), part 1957.
6730. gbpln1958.seq - Plant sequence entries (including fungi and algae), part 1958.
6731. gbpln1959.seq - Plant sequence entries (including fungi and algae), part 1959.
6732. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
6733. gbpln1960.seq - Plant sequence entries (including fungi and algae), part 1960.
6734. gbpln1961.seq - Plant sequence entries (including fungi and algae), part 1961.
6735. gbpln1962.seq - Plant sequence entries (including fungi and algae), part 1962.
6736. gbpln1963.seq - Plant sequence entries (including fungi and algae), part 1963.
6737. gbpln1964.seq - Plant sequence entries (including fungi and algae), part 1964.
6738. gbpln1965.seq - Plant sequence entries (including fungi and algae), part 1965.
6739. gbpln1966.seq - Plant sequence entries (including fungi and algae), part 1966.
6740. gbpln1967.seq - Plant sequence entries (including fungi and algae), part 1967.
6741. gbpln1968.seq - Plant sequence entries (including fungi and algae), part 1968.
6742. gbpln1969.seq - Plant sequence entries (including fungi and algae), part 1969.
6743. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
6744. gbpln1970.seq - Plant sequence entries (including fungi and algae), part 1970.
6745. gbpln1971.seq - Plant sequence entries (including fungi and algae), part 1971.
6746. gbpln1972.seq - Plant sequence entries (including fungi and algae), part 1972.
6747. gbpln1973.seq - Plant sequence entries (including fungi and algae), part 1973.
6748. gbpln1974.seq - Plant sequence entries (including fungi and algae), part 1974.
6749. gbpln1975.seq - Plant sequence entries (including fungi and algae), part 1975.
6750. gbpln1976.seq - Plant sequence entries (including fungi and algae), part 1976.
6751. gbpln1977.seq - Plant sequence entries (including fungi and algae), part 1977.
6752. gbpln1978.seq - Plant sequence entries (including fungi and algae), part 1978.
6753. gbpln1979.seq - Plant sequence entries (including fungi and algae), part 1979.
6754. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
6755. gbpln1980.seq - Plant sequence entries (including fungi and algae), part 1980.
6756. gbpln1981.seq - Plant sequence entries (including fungi and algae), part 1981.
6757. gbpln1982.seq - Plant sequence entries (including fungi and algae), part 1982.
6758. gbpln1983.seq - Plant sequence entries (including fungi and algae), part 1983.
6759. gbpln1984.seq - Plant sequence entries (including fungi and algae), part 1984.
6760. gbpln1985.seq - Plant sequence entries (including fungi and algae), part 1985.
6761. gbpln1986.seq - Plant sequence entries (including fungi and algae), part 1986.
6762. gbpln1987.seq - Plant sequence entries (including fungi and algae), part 1987.
6763. gbpln1988.seq - Plant sequence entries (including fungi and algae), part 1988.
6764. gbpln1989.seq - Plant sequence entries (including fungi and algae), part 1989.
6765. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
6766. gbpln1990.seq - Plant sequence entries (including fungi and algae), part 1990.
6767. gbpln1991.seq - Plant sequence entries (including fungi and algae), part 1991.
6768. gbpln1992.seq - Plant sequence entries (including fungi and algae), part 1992.
6769. gbpln1993.seq - Plant sequence entries (including fungi and algae), part 1993.
6770. gbpln1994.seq - Plant sequence entries (including fungi and algae), part 1994.
6771. gbpln1995.seq - Plant sequence entries (including fungi and algae), part 1995.
6772. gbpln1996.seq - Plant sequence entries (including fungi and algae), part 1996.
6773. gbpln1997.seq - Plant sequence entries (including fungi and algae), part 1997.
6774. gbpln1998.seq - Plant sequence entries (including fungi and algae), part 1998.
6775. gbpln1999.seq - Plant sequence entries (including fungi and algae), part 1999.
6776. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
6777. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
6778. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
6779. gbpln2000.seq - Plant sequence entries (including fungi and algae), part 2000.
6780. gbpln2001.seq - Plant sequence entries (including fungi and algae), part 2001.
6781. gbpln2002.seq - Plant sequence entries (including fungi and algae), part 2002.
6782. gbpln2003.seq - Plant sequence entries (including fungi and algae), part 2003.
6783. gbpln2004.seq - Plant sequence entries (including fungi and algae), part 2004.
6784. gbpln2005.seq - Plant sequence entries (including fungi and algae), part 2005.
6785. gbpln2006.seq - Plant sequence entries (including fungi and algae), part 2006.
6786. gbpln2007.seq - Plant sequence entries (including fungi and algae), part 2007.
6787. gbpln2008.seq - Plant sequence entries (including fungi and algae), part 2008.
6788. gbpln2009.seq - Plant sequence entries (including fungi and algae), part 2009.
6789. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
6790. gbpln2010.seq - Plant sequence entries (including fungi and algae), part 2010.
6791. gbpln2011.seq - Plant sequence entries (including fungi and algae), part 2011.
6792. gbpln2012.seq - Plant sequence entries (including fungi and algae), part 2012.
6793. gbpln2013.seq - Plant sequence entries (including fungi and algae), part 2013.
6794. gbpln2014.seq - Plant sequence entries (including fungi and algae), part 2014.
6795. gbpln2015.seq - Plant sequence entries (including fungi and algae), part 2015.
6796. gbpln2016.seq - Plant sequence entries (including fungi and algae), part 2016.
6797. gbpln2017.seq - Plant sequence entries (including fungi and algae), part 2017.
6798. gbpln2018.seq - Plant sequence entries (including fungi and algae), part 2018.
6799. gbpln2019.seq - Plant sequence entries (including fungi and algae), part 2019.
6800. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
6801. gbpln2020.seq - Plant sequence entries (including fungi and algae), part 2020.
6802. gbpln2021.seq - Plant sequence entries (including fungi and algae), part 2021.
6803. gbpln2022.seq - Plant sequence entries (including fungi and algae), part 2022.
6804. gbpln2023.seq - Plant sequence entries (including fungi and algae), part 2023.
6805. gbpln2024.seq - Plant sequence entries (including fungi and algae), part 2024.
6806. gbpln2025.seq - Plant sequence entries (including fungi and algae), part 2025.
6807. gbpln2026.seq - Plant sequence entries (including fungi and algae), part 2026.
6808. gbpln2027.seq - Plant sequence entries (including fungi and algae), part 2027.
6809. gbpln2028.seq - Plant sequence entries (including fungi and algae), part 2028.
6810. gbpln2029.seq - Plant sequence entries (including fungi and algae), part 2029.
6811. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
6812. gbpln2030.seq - Plant sequence entries (including fungi and algae), part 2030.
6813. gbpln2031.seq - Plant sequence entries (including fungi and algae), part 2031.
6814. gbpln2032.seq - Plant sequence entries (including fungi and algae), part 2032.
6815. gbpln2033.seq - Plant sequence entries (including fungi and algae), part 2033.
6816. gbpln2034.seq - Plant sequence entries (including fungi and algae), part 2034.
6817. gbpln2035.seq - Plant sequence entries (including fungi and algae), part 2035.
6818. gbpln2036.seq - Plant sequence entries (including fungi and algae), part 2036.
6819. gbpln2037.seq - Plant sequence entries (including fungi and algae), part 2037.
6820. gbpln2038.seq - Plant sequence entries (including fungi and algae), part 2038.
6821. gbpln2039.seq - Plant sequence entries (including fungi and algae), part 2039.
6822. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
6823. gbpln2040.seq - Plant sequence entries (including fungi and algae), part 2040.
6824. gbpln2041.seq - Plant sequence entries (including fungi and algae), part 2041.
6825. gbpln2042.seq - Plant sequence entries (including fungi and algae), part 2042.
6826. gbpln2043.seq - Plant sequence entries (including fungi and algae), part 2043.
6827. gbpln2044.seq - Plant sequence entries (including fungi and algae), part 2044.
6828. gbpln2045.seq - Plant sequence entries (including fungi and algae), part 2045.
6829. gbpln2046.seq - Plant sequence entries (including fungi and algae), part 2046.
6830. gbpln2047.seq - Plant sequence entries (including fungi and algae), part 2047.
6831. gbpln2048.seq - Plant sequence entries (including fungi and algae), part 2048.
6832. gbpln2049.seq - Plant sequence entries (including fungi and algae), part 2049.
6833. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
6834. gbpln2050.seq - Plant sequence entries (including fungi and algae), part 2050.
6835. gbpln2051.seq - Plant sequence entries (including fungi and algae), part 2051.
6836. gbpln2052.seq - Plant sequence entries (including fungi and algae), part 2052.
6837. gbpln2053.seq - Plant sequence entries (including fungi and algae), part 2053.
6838. gbpln2054.seq - Plant sequence entries (including fungi and algae), part 2054.
6839. gbpln2055.seq - Plant sequence entries (including fungi and algae), part 2055.
6840. gbpln2056.seq - Plant sequence entries (including fungi and algae), part 2056.
6841. gbpln2057.seq - Plant sequence entries (including fungi and algae), part 2057.
6842. gbpln2058.seq - Plant sequence entries (including fungi and algae), part 2058.
6843. gbpln2059.seq - Plant sequence entries (including fungi and algae), part 2059.
6844. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
6845. gbpln2060.seq - Plant sequence entries (including fungi and algae), part 2060.
6846. gbpln2061.seq - Plant sequence entries (including fungi and algae), part 2061.
6847. gbpln2062.seq - Plant sequence entries (including fungi and algae), part 2062.
6848. gbpln2063.seq - Plant sequence entries (including fungi and algae), part 2063.
6849. gbpln2064.seq - Plant sequence entries (including fungi and algae), part 2064.
6850. gbpln2065.seq - Plant sequence entries (including fungi and algae), part 2065.
6851. gbpln2066.seq - Plant sequence entries (including fungi and algae), part 2066.
6852. gbpln2067.seq - Plant sequence entries (including fungi and algae), part 2067.
6853. gbpln2068.seq - Plant sequence entries (including fungi and algae), part 2068.
6854. gbpln2069.seq - Plant sequence entries (including fungi and algae), part 2069.
6855. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
6856. gbpln2070.seq - Plant sequence entries (including fungi and algae), part 2070.
6857. gbpln2071.seq - Plant sequence entries (including fungi and algae), part 2071.
6858. gbpln2072.seq - Plant sequence entries (including fungi and algae), part 2072.
6859. gbpln2073.seq - Plant sequence entries (including fungi and algae), part 2073.
6860. gbpln2074.seq - Plant sequence entries (including fungi and algae), part 2074.
6861. gbpln2075.seq - Plant sequence entries (including fungi and algae), part 2075.
6862. gbpln2076.seq - Plant sequence entries (including fungi and algae), part 2076.
6863. gbpln2077.seq - Plant sequence entries (including fungi and algae), part 2077.
6864. gbpln2078.seq - Plant sequence entries (including fungi and algae), part 2078.
6865. gbpln2079.seq - Plant sequence entries (including fungi and algae), part 2079.
6866. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
6867. gbpln2080.seq - Plant sequence entries (including fungi and algae), part 2080.
6868. gbpln2081.seq - Plant sequence entries (including fungi and algae), part 2081.
6869. gbpln2082.seq - Plant sequence entries (including fungi and algae), part 2082.
6870. gbpln2083.seq - Plant sequence entries (including fungi and algae), part 2083.
6871. gbpln2084.seq - Plant sequence entries (including fungi and algae), part 2084.
6872. gbpln2085.seq - Plant sequence entries (including fungi and algae), part 2085.
6873. gbpln2086.seq - Plant sequence entries (including fungi and algae), part 2086.
6874. gbpln2087.seq - Plant sequence entries (including fungi and algae), part 2087.
6875. gbpln2088.seq - Plant sequence entries (including fungi and algae), part 2088.
6876. gbpln2089.seq - Plant sequence entries (including fungi and algae), part 2089.
6877. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
6878. gbpln2090.seq - Plant sequence entries (including fungi and algae), part 2090.
6879. gbpln2091.seq - Plant sequence entries (including fungi and algae), part 2091.
6880. gbpln2092.seq - Plant sequence entries (including fungi and algae), part 2092.
6881. gbpln2093.seq - Plant sequence entries (including fungi and algae), part 2093.
6882. gbpln2094.seq - Plant sequence entries (including fungi and algae), part 2094.
6883. gbpln2095.seq - Plant sequence entries (including fungi and algae), part 2095.
6884. gbpln2096.seq - Plant sequence entries (including fungi and algae), part 2096.
6885. gbpln2097.seq - Plant sequence entries (including fungi and algae), part 2097.
6886. gbpln2098.seq - Plant sequence entries (including fungi and algae), part 2098.
6887. gbpln2099.seq - Plant sequence entries (including fungi and algae), part 2099.
6888. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
6889. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
6890. gbpln2100.seq - Plant sequence entries (including fungi and algae), part 2100.
6891. gbpln2101.seq - Plant sequence entries (including fungi and algae), part 2101.
6892. gbpln2102.seq - Plant sequence entries (including fungi and algae), part 2102.
6893. gbpln2103.seq - Plant sequence entries (including fungi and algae), part 2103.
6894. gbpln2104.seq - Plant sequence entries (including fungi and algae), part 2104.
6895. gbpln2105.seq - Plant sequence entries (including fungi and algae), part 2105.
6896. gbpln2106.seq - Plant sequence entries (including fungi and algae), part 2106.
6897. gbpln2107.seq - Plant sequence entries (including fungi and algae), part 2107.
6898. gbpln2108.seq - Plant sequence entries (including fungi and algae), part 2108.
6899. gbpln2109.seq - Plant sequence entries (including fungi and algae), part 2109.
6900. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
6901. gbpln2110.seq - Plant sequence entries (including fungi and algae), part 2110.
6902. gbpln2111.seq - Plant sequence entries (including fungi and algae), part 2111.
6903. gbpln2112.seq - Plant sequence entries (including fungi and algae), part 2112.
6904. gbpln2113.seq - Plant sequence entries (including fungi and algae), part 2113.
6905. gbpln2114.seq - Plant sequence entries (including fungi and algae), part 2114.
6906. gbpln2115.seq - Plant sequence entries (including fungi and algae), part 2115.
6907. gbpln2116.seq - Plant sequence entries (including fungi and algae), part 2116.
6908. gbpln2117.seq - Plant sequence entries (including fungi and algae), part 2117.
6909. gbpln2118.seq - Plant sequence entries (including fungi and algae), part 2118.
6910. gbpln2119.seq - Plant sequence entries (including fungi and algae), part 2119.
6911. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
6912. gbpln2120.seq - Plant sequence entries (including fungi and algae), part 2120.
6913. gbpln2121.seq - Plant sequence entries (including fungi and algae), part 2121.
6914. gbpln2122.seq - Plant sequence entries (including fungi and algae), part 2122.
6915. gbpln2123.seq - Plant sequence entries (including fungi and algae), part 2123.
6916. gbpln2124.seq - Plant sequence entries (including fungi and algae), part 2124.
6917. gbpln2125.seq - Plant sequence entries (including fungi and algae), part 2125.
6918. gbpln2126.seq - Plant sequence entries (including fungi and algae), part 2126.
6919. gbpln2127.seq - Plant sequence entries (including fungi and algae), part 2127.
6920. gbpln2128.seq - Plant sequence entries (including fungi and algae), part 2128.
6921. gbpln2129.seq - Plant sequence entries (including fungi and algae), part 2129.
6922. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
6923. gbpln2130.seq - Plant sequence entries (including fungi and algae), part 2130.
6924. gbpln2131.seq - Plant sequence entries (including fungi and algae), part 2131.
6925. gbpln2132.seq - Plant sequence entries (including fungi and algae), part 2132.
6926. gbpln2133.seq - Plant sequence entries (including fungi and algae), part 2133.
6927. gbpln2134.seq - Plant sequence entries (including fungi and algae), part 2134.
6928. gbpln2135.seq - Plant sequence entries (including fungi and algae), part 2135.
6929. gbpln2136.seq - Plant sequence entries (including fungi and algae), part 2136.
6930. gbpln2137.seq - Plant sequence entries (including fungi and algae), part 2137.
6931. gbpln2138.seq - Plant sequence entries (including fungi and algae), part 2138.
6932. gbpln2139.seq - Plant sequence entries (including fungi and algae), part 2139.
6933. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
6934. gbpln2140.seq - Plant sequence entries (including fungi and algae), part 2140.
6935. gbpln2141.seq - Plant sequence entries (including fungi and algae), part 2141.
6936. gbpln2142.seq - Plant sequence entries (including fungi and algae), part 2142.
6937. gbpln2143.seq - Plant sequence entries (including fungi and algae), part 2143.
6938. gbpln2144.seq - Plant sequence entries (including fungi and algae), part 2144.
6939. gbpln2145.seq - Plant sequence entries (including fungi and algae), part 2145.
6940. gbpln2146.seq - Plant sequence entries (including fungi and algae), part 2146.
6941. gbpln2147.seq - Plant sequence entries (including fungi and algae), part 2147.
6942. gbpln2148.seq - Plant sequence entries (including fungi and algae), part 2148.
6943. gbpln2149.seq - Plant sequence entries (including fungi and algae), part 2149.
6944. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
6945. gbpln2150.seq - Plant sequence entries (including fungi and algae), part 2150.
6946. gbpln2151.seq - Plant sequence entries (including fungi and algae), part 2151.
6947. gbpln2152.seq - Plant sequence entries (including fungi and algae), part 2152.
6948. gbpln2153.seq - Plant sequence entries (including fungi and algae), part 2153.
6949. gbpln2154.seq - Plant sequence entries (including fungi and algae), part 2154.
6950. gbpln2155.seq - Plant sequence entries (including fungi and algae), part 2155.
6951. gbpln2156.seq - Plant sequence entries (including fungi and algae), part 2156.
6952. gbpln2157.seq - Plant sequence entries (including fungi and algae), part 2157.
6953. gbpln2158.seq - Plant sequence entries (including fungi and algae), part 2158.
6954. gbpln2159.seq - Plant sequence entries (including fungi and algae), part 2159.
6955. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
6956. gbpln2160.seq - Plant sequence entries (including fungi and algae), part 2160.
6957. gbpln2161.seq - Plant sequence entries (including fungi and algae), part 2161.
6958. gbpln2162.seq - Plant sequence entries (including fungi and algae), part 2162.
6959. gbpln2163.seq - Plant sequence entries (including fungi and algae), part 2163.
6960. gbpln2164.seq - Plant sequence entries (including fungi and algae), part 2164.
6961. gbpln2165.seq - Plant sequence entries (including fungi and algae), part 2165.
6962. gbpln2166.seq - Plant sequence entries (including fungi and algae), part 2166.
6963. gbpln2167.seq - Plant sequence entries (including fungi and algae), part 2167.
6964. gbpln2168.seq - Plant sequence entries (including fungi and algae), part 2168.
6965. gbpln2169.seq - Plant sequence entries (including fungi and algae), part 2169.
6966. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
6967. gbpln2170.seq - Plant sequence entries (including fungi and algae), part 2170.
6968. gbpln2171.seq - Plant sequence entries (including fungi and algae), part 2171.
6969. gbpln2172.seq - Plant sequence entries (including fungi and algae), part 2172.
6970. gbpln2173.seq - Plant sequence entries (including fungi and algae), part 2173.
6971. gbpln2174.seq - Plant sequence entries (including fungi and algae), part 2174.
6972. gbpln2175.seq - Plant sequence entries (including fungi and algae), part 2175.
6973. gbpln2176.seq - Plant sequence entries (including fungi and algae), part 2176.
6974. gbpln2177.seq - Plant sequence entries (including fungi and algae), part 2177.
6975. gbpln2178.seq - Plant sequence entries (including fungi and algae), part 2178.
6976. gbpln2179.seq - Plant sequence entries (including fungi and algae), part 2179.
6977. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
6978. gbpln2180.seq - Plant sequence entries (including fungi and algae), part 2180.
6979. gbpln2181.seq - Plant sequence entries (including fungi and algae), part 2181.
6980. gbpln2182.seq - Plant sequence entries (including fungi and algae), part 2182.
6981. gbpln2183.seq - Plant sequence entries (including fungi and algae), part 2183.
6982. gbpln2184.seq - Plant sequence entries (including fungi and algae), part 2184.
6983. gbpln2185.seq - Plant sequence entries (including fungi and algae), part 2185.
6984. gbpln2186.seq - Plant sequence entries (including fungi and algae), part 2186.
6985. gbpln2187.seq - Plant sequence entries (including fungi and algae), part 2187.
6986. gbpln2188.seq - Plant sequence entries (including fungi and algae), part 2188.
6987. gbpln2189.seq - Plant sequence entries (including fungi and algae), part 2189.
6988. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
6989. gbpln2190.seq - Plant sequence entries (including fungi and algae), part 2190.
6990. gbpln2191.seq - Plant sequence entries (including fungi and algae), part 2191.
6991. gbpln2192.seq - Plant sequence entries (including fungi and algae), part 2192.
6992. gbpln2193.seq - Plant sequence entries (including fungi and algae), part 2193.
6993. gbpln2194.seq - Plant sequence entries (including fungi and algae), part 2194.
6994. gbpln2195.seq - Plant sequence entries (including fungi and algae), part 2195.
6995. gbpln2196.seq - Plant sequence entries (including fungi and algae), part 2196.
6996. gbpln2197.seq - Plant sequence entries (including fungi and algae), part 2197.
6997. gbpln2198.seq - Plant sequence entries (including fungi and algae), part 2198.
6998. gbpln2199.seq - Plant sequence entries (including fungi and algae), part 2199.
6999. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
7000. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
7001. gbpln2200.seq - Plant sequence entries (including fungi and algae), part 2200.
7002. gbpln2201.seq - Plant sequence entries (including fungi and algae), part 2201.
7003. gbpln2202.seq - Plant sequence entries (including fungi and algae), part 2202.
7004. gbpln2203.seq - Plant sequence entries (including fungi and algae), part 2203.
7005. gbpln2204.seq - Plant sequence entries (including fungi and algae), part 2204.
7006. gbpln2205.seq - Plant sequence entries (including fungi and algae), part 2205.
7007. gbpln2206.seq - Plant sequence entries (including fungi and algae), part 2206.
7008. gbpln2207.seq - Plant sequence entries (including fungi and algae), part 2207.
7009. gbpln2208.seq - Plant sequence entries (including fungi and algae), part 2208.
7010. gbpln2209.seq - Plant sequence entries (including fungi and algae), part 2209.
7011. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
7012. gbpln2210.seq - Plant sequence entries (including fungi and algae), part 2210.
7013. gbpln2211.seq - Plant sequence entries (including fungi and algae), part 2211.
7014. gbpln2212.seq - Plant sequence entries (including fungi and algae), part 2212.
7015. gbpln2213.seq - Plant sequence entries (including fungi and algae), part 2213.
7016. gbpln2214.seq - Plant sequence entries (including fungi and algae), part 2214.
7017. gbpln2215.seq - Plant sequence entries (including fungi and algae), part 2215.
7018. gbpln2216.seq - Plant sequence entries (including fungi and algae), part 2216.
7019. gbpln2217.seq - Plant sequence entries (including fungi and algae), part 2217.
7020. gbpln2218.seq - Plant sequence entries (including fungi and algae), part 2218.
7021. gbpln2219.seq - Plant sequence entries (including fungi and algae), part 2219.
7022. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
7023. gbpln2220.seq - Plant sequence entries (including fungi and algae), part 2220.
7024. gbpln2221.seq - Plant sequence entries (including fungi and algae), part 2221.
7025. gbpln2222.seq - Plant sequence entries (including fungi and algae), part 2222.
7026. gbpln2223.seq - Plant sequence entries (including fungi and algae), part 2223.
7027. gbpln2224.seq - Plant sequence entries (including fungi and algae), part 2224.
7028. gbpln2225.seq - Plant sequence entries (including fungi and algae), part 2225.
7029. gbpln2226.seq - Plant sequence entries (including fungi and algae), part 2226.
7030. gbpln2227.seq - Plant sequence entries (including fungi and algae), part 2227.
7031. gbpln2228.seq - Plant sequence entries (including fungi and algae), part 2228.
7032. gbpln2229.seq - Plant sequence entries (including fungi and algae), part 2229.
7033. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
7034. gbpln2230.seq - Plant sequence entries (including fungi and algae), part 2230.
7035. gbpln2231.seq - Plant sequence entries (including fungi and algae), part 2231.
7036. gbpln2232.seq - Plant sequence entries (including fungi and algae), part 2232.
7037. gbpln2233.seq - Plant sequence entries (including fungi and algae), part 2233.
7038. gbpln2234.seq - Plant sequence entries (including fungi and algae), part 2234.
7039. gbpln2235.seq - Plant sequence entries (including fungi and algae), part 2235.
7040. gbpln2236.seq - Plant sequence entries (including fungi and algae), part 2236.
7041. gbpln2237.seq - Plant sequence entries (including fungi and algae), part 2237.
7042. gbpln2238.seq - Plant sequence entries (including fungi and algae), part 2238.
7043. gbpln2239.seq - Plant sequence entries (including fungi and algae), part 2239.
7044. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
7045. gbpln2240.seq - Plant sequence entries (including fungi and algae), part 2240.
7046. gbpln2241.seq - Plant sequence entries (including fungi and algae), part 2241.
7047. gbpln2242.seq - Plant sequence entries (including fungi and algae), part 2242.
7048. gbpln2243.seq - Plant sequence entries (including fungi and algae), part 2243.
7049. gbpln2244.seq - Plant sequence entries (including fungi and algae), part 2244.
7050. gbpln2245.seq - Plant sequence entries (including fungi and algae), part 2245.
7051. gbpln2246.seq - Plant sequence entries (including fungi and algae), part 2246.
7052. gbpln2247.seq - Plant sequence entries (including fungi and algae), part 2247.
7053. gbpln2248.seq - Plant sequence entries (including fungi and algae), part 2248.
7054. gbpln2249.seq - Plant sequence entries (including fungi and algae), part 2249.
7055. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
7056. gbpln2250.seq - Plant sequence entries (including fungi and algae), part 2250.
7057. gbpln2251.seq - Plant sequence entries (including fungi and algae), part 2251.
7058. gbpln2252.seq - Plant sequence entries (including fungi and algae), part 2252.
7059. gbpln2253.seq - Plant sequence entries (including fungi and algae), part 2253.
7060. gbpln2254.seq - Plant sequence entries (including fungi and algae), part 2254.
7061. gbpln2255.seq - Plant sequence entries (including fungi and algae), part 2255.
7062. gbpln2256.seq - Plant sequence entries (including fungi and algae), part 2256.
7063. gbpln2257.seq - Plant sequence entries (including fungi and algae), part 2257.
7064. gbpln2258.seq - Plant sequence entries (including fungi and algae), part 2258.
7065. gbpln2259.seq - Plant sequence entries (including fungi and algae), part 2259.
7066. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
7067. gbpln2260.seq - Plant sequence entries (including fungi and algae), part 2260.
7068. gbpln2261.seq - Plant sequence entries (including fungi and algae), part 2261.
7069. gbpln2262.seq - Plant sequence entries (including fungi and algae), part 2262.
7070. gbpln2263.seq - Plant sequence entries (including fungi and algae), part 2263.
7071. gbpln2264.seq - Plant sequence entries (including fungi and algae), part 2264.
7072. gbpln2265.seq - Plant sequence entries (including fungi and algae), part 2265.
7073. gbpln2266.seq - Plant sequence entries (including fungi and algae), part 2266.
7074. gbpln2267.seq - Plant sequence entries (including fungi and algae), part 2267.
7075. gbpln2268.seq - Plant sequence entries (including fungi and algae), part 2268.
7076. gbpln2269.seq - Plant sequence entries (including fungi and algae), part 2269.
7077. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
7078. gbpln2270.seq - Plant sequence entries (including fungi and algae), part 2270.
7079. gbpln2271.seq - Plant sequence entries (including fungi and algae), part 2271.
7080. gbpln2272.seq - Plant sequence entries (including fungi and algae), part 2272.
7081. gbpln2273.seq - Plant sequence entries (including fungi and algae), part 2273.
7082. gbpln2274.seq - Plant sequence entries (including fungi and algae), part 2274.
7083. gbpln2275.seq - Plant sequence entries (including fungi and algae), part 2275.
7084. gbpln2276.seq - Plant sequence entries (including fungi and algae), part 2276.
7085. gbpln2277.seq - Plant sequence entries (including fungi and algae), part 2277.
7086. gbpln2278.seq - Plant sequence entries (including fungi and algae), part 2278.
7087. gbpln2279.seq - Plant sequence entries (including fungi and algae), part 2279.
7088. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
7089. gbpln2280.seq - Plant sequence entries (including fungi and algae), part 2280.
7090. gbpln2281.seq - Plant sequence entries (including fungi and algae), part 2281.
7091. gbpln2282.seq - Plant sequence entries (including fungi and algae), part 2282.
7092. gbpln2283.seq - Plant sequence entries (including fungi and algae), part 2283.
7093. gbpln2284.seq - Plant sequence entries (including fungi and algae), part 2284.
7094. gbpln2285.seq - Plant sequence entries (including fungi and algae), part 2285.
7095. gbpln2286.seq - Plant sequence entries (including fungi and algae), part 2286.
7096. gbpln2287.seq - Plant sequence entries (including fungi and algae), part 2287.
7097. gbpln2288.seq - Plant sequence entries (including fungi and algae), part 2288.
7098. gbpln2289.seq - Plant sequence entries (including fungi and algae), part 2289.
7099. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
7100. gbpln2290.seq - Plant sequence entries (including fungi and algae), part 2290.
7101. gbpln2291.seq - Plant sequence entries (including fungi and algae), part 2291.
7102. gbpln2292.seq - Plant sequence entries (including fungi and algae), part 2292.
7103. gbpln2293.seq - Plant sequence entries (including fungi and algae), part 2293.
7104. gbpln2294.seq - Plant sequence entries (including fungi and algae), part 2294.
7105. gbpln2295.seq - Plant sequence entries (including fungi and algae), part 2295.
7106. gbpln2296.seq - Plant sequence entries (including fungi and algae), part 2296.
7107. gbpln2297.seq - Plant sequence entries (including fungi and algae), part 2297.
7108. gbpln2298.seq - Plant sequence entries (including fungi and algae), part 2298.
7109. gbpln2299.seq - Plant sequence entries (including fungi and algae), part 2299.
7110. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
7111. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
7112. gbpln2300.seq - Plant sequence entries (including fungi and algae), part 2300.
7113. gbpln2301.seq - Plant sequence entries (including fungi and algae), part 2301.
7114. gbpln2302.seq - Plant sequence entries (including fungi and algae), part 2302.
7115. gbpln2303.seq - Plant sequence entries (including fungi and algae), part 2303.
7116. gbpln2304.seq - Plant sequence entries (including fungi and algae), part 2304.
7117. gbpln2305.seq - Plant sequence entries (including fungi and algae), part 2305.
7118. gbpln2306.seq - Plant sequence entries (including fungi and algae), part 2306.
7119. gbpln2307.seq - Plant sequence entries (including fungi and algae), part 2307.
7120. gbpln2308.seq - Plant sequence entries (including fungi and algae), part 2308.
7121. gbpln2309.seq - Plant sequence entries (including fungi and algae), part 2309.
7122. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
7123. gbpln2310.seq - Plant sequence entries (including fungi and algae), part 2310.
7124. gbpln2311.seq - Plant sequence entries (including fungi and algae), part 2311.
7125. gbpln2312.seq - Plant sequence entries (including fungi and algae), part 2312.
7126. gbpln2313.seq - Plant sequence entries (including fungi and algae), part 2313.
7127. gbpln2314.seq - Plant sequence entries (including fungi and algae), part 2314.
7128. gbpln2315.seq - Plant sequence entries (including fungi and algae), part 2315.
7129. gbpln2316.seq - Plant sequence entries (including fungi and algae), part 2316.
7130. gbpln2317.seq - Plant sequence entries (including fungi and algae), part 2317.
7131. gbpln2318.seq - Plant sequence entries (including fungi and algae), part 2318.
7132. gbpln2319.seq - Plant sequence entries (including fungi and algae), part 2319.
7133. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
7134. gbpln2320.seq - Plant sequence entries (including fungi and algae), part 2320.
7135. gbpln2321.seq - Plant sequence entries (including fungi and algae), part 2321.
7136. gbpln2322.seq - Plant sequence entries (including fungi and algae), part 2322.
7137. gbpln2323.seq - Plant sequence entries (including fungi and algae), part 2323.
7138. gbpln2324.seq - Plant sequence entries (including fungi and algae), part 2324.
7139. gbpln2325.seq - Plant sequence entries (including fungi and algae), part 2325.
7140. gbpln2326.seq - Plant sequence entries (including fungi and algae), part 2326.
7141. gbpln2327.seq - Plant sequence entries (including fungi and algae), part 2327.
7142. gbpln2328.seq - Plant sequence entries (including fungi and algae), part 2328.
7143. gbpln2329.seq - Plant sequence entries (including fungi and algae), part 2329.
7144. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
7145. gbpln2330.seq - Plant sequence entries (including fungi and algae), part 2330.
7146. gbpln2331.seq - Plant sequence entries (including fungi and algae), part 2331.
7147. gbpln2332.seq - Plant sequence entries (including fungi and algae), part 2332.
7148. gbpln2333.seq - Plant sequence entries (including fungi and algae), part 2333.
7149. gbpln2334.seq - Plant sequence entries (including fungi and algae), part 2334.
7150. gbpln2335.seq - Plant sequence entries (including fungi and algae), part 2335.
7151. gbpln2336.seq - Plant sequence entries (including fungi and algae), part 2336.
7152. gbpln2337.seq - Plant sequence entries (including fungi and algae), part 2337.
7153. gbpln2338.seq - Plant sequence entries (including fungi and algae), part 2338.
7154. gbpln2339.seq - Plant sequence entries (including fungi and algae), part 2339.
7155. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
7156. gbpln2340.seq - Plant sequence entries (including fungi and algae), part 2340.
7157. gbpln2341.seq - Plant sequence entries (including fungi and algae), part 2341.
7158. gbpln2342.seq - Plant sequence entries (including fungi and algae), part 2342.
7159. gbpln2343.seq - Plant sequence entries (including fungi and algae), part 2343.
7160. gbpln2344.seq - Plant sequence entries (including fungi and algae), part 2344.
7161. gbpln2345.seq - Plant sequence entries (including fungi and algae), part 2345.
7162. gbpln2346.seq - Plant sequence entries (including fungi and algae), part 2346.
7163. gbpln2347.seq - Plant sequence entries (including fungi and algae), part 2347.
7164. gbpln2348.seq - Plant sequence entries (including fungi and algae), part 2348.
7165. gbpln2349.seq - Plant sequence entries (including fungi and algae), part 2349.
7166. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
7167. gbpln2350.seq - Plant sequence entries (including fungi and algae), part 2350.
7168. gbpln2351.seq - Plant sequence entries (including fungi and algae), part 2351.
7169. gbpln2352.seq - Plant sequence entries (including fungi and algae), part 2352.
7170. gbpln2353.seq - Plant sequence entries (including fungi and algae), part 2353.
7171. gbpln2354.seq - Plant sequence entries (including fungi and algae), part 2354.
7172. gbpln2355.seq - Plant sequence entries (including fungi and algae), part 2355.
7173. gbpln2356.seq - Plant sequence entries (including fungi and algae), part 2356.
7174. gbpln2357.seq - Plant sequence entries (including fungi and algae), part 2357.
7175. gbpln2358.seq - Plant sequence entries (including fungi and algae), part 2358.
7176. gbpln2359.seq - Plant sequence entries (including fungi and algae), part 2359.
7177. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
7178. gbpln2360.seq - Plant sequence entries (including fungi and algae), part 2360.
7179. gbpln2361.seq - Plant sequence entries (including fungi and algae), part 2361.
7180. gbpln2362.seq - Plant sequence entries (including fungi and algae), part 2362.
7181. gbpln2363.seq - Plant sequence entries (including fungi and algae), part 2363.
7182. gbpln2364.seq - Plant sequence entries (including fungi and algae), part 2364.
7183. gbpln2365.seq - Plant sequence entries (including fungi and algae), part 2365.
7184. gbpln2366.seq - Plant sequence entries (including fungi and algae), part 2366.
7185. gbpln2367.seq - Plant sequence entries (including fungi and algae), part 2367.
7186. gbpln2368.seq - Plant sequence entries (including fungi and algae), part 2368.
7187. gbpln2369.seq - Plant sequence entries (including fungi and algae), part 2369.
7188. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
7189. gbpln2370.seq - Plant sequence entries (including fungi and algae), part 2370.
7190. gbpln2371.seq - Plant sequence entries (including fungi and algae), part 2371.
7191. gbpln2372.seq - Plant sequence entries (including fungi and algae), part 2372.
7192. gbpln2373.seq - Plant sequence entries (including fungi and algae), part 2373.
7193. gbpln2374.seq - Plant sequence entries (including fungi and algae), part 2374.
7194. gbpln2375.seq - Plant sequence entries (including fungi and algae), part 2375.
7195. gbpln2376.seq - Plant sequence entries (including fungi and algae), part 2376.
7196. gbpln2377.seq - Plant sequence entries (including fungi and algae), part 2377.
7197. gbpln2378.seq - Plant sequence entries (including fungi and algae), part 2378.
7198. gbpln2379.seq - Plant sequence entries (including fungi and algae), part 2379.
7199. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
7200. gbpln2380.seq - Plant sequence entries (including fungi and algae), part 2380.
7201. gbpln2381.seq - Plant sequence entries (including fungi and algae), part 2381.
7202. gbpln2382.seq - Plant sequence entries (including fungi and algae), part 2382.
7203. gbpln2383.seq - Plant sequence entries (including fungi and algae), part 2383.
7204. gbpln2384.seq - Plant sequence entries (including fungi and algae), part 2384.
7205. gbpln2385.seq - Plant sequence entries (including fungi and algae), part 2385.
7206. gbpln2386.seq - Plant sequence entries (including fungi and algae), part 2386.
7207. gbpln2387.seq - Plant sequence entries (including fungi and algae), part 2387.
7208. gbpln2388.seq - Plant sequence entries (including fungi and algae), part 2388.
7209. gbpln2389.seq - Plant sequence entries (including fungi and algae), part 2389.
7210. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
7211. gbpln2390.seq - Plant sequence entries (including fungi and algae), part 2390.
7212. gbpln2391.seq - Plant sequence entries (including fungi and algae), part 2391.
7213. gbpln2392.seq - Plant sequence entries (including fungi and algae), part 2392.
7214. gbpln2393.seq - Plant sequence entries (including fungi and algae), part 2393.
7215. gbpln2394.seq - Plant sequence entries (including fungi and algae), part 2394.
7216. gbpln2395.seq - Plant sequence entries (including fungi and algae), part 2395.
7217. gbpln2396.seq - Plant sequence entries (including fungi and algae), part 2396.
7218. gbpln2397.seq - Plant sequence entries (including fungi and algae), part 2397.
7219. gbpln2398.seq - Plant sequence entries (including fungi and algae), part 2398.
7220. gbpln2399.seq - Plant sequence entries (including fungi and algae), part 2399.
7221. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
7222. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
7223. gbpln2400.seq - Plant sequence entries (including fungi and algae), part 2400.
7224. gbpln2401.seq - Plant sequence entries (including fungi and algae), part 2401.
7225. gbpln2402.seq - Plant sequence entries (including fungi and algae), part 2402.
7226. gbpln2403.seq - Plant sequence entries (including fungi and algae), part 2403.
7227. gbpln2404.seq - Plant sequence entries (including fungi and algae), part 2404.
7228. gbpln2405.seq - Plant sequence entries (including fungi and algae), part 2405.
7229. gbpln2406.seq - Plant sequence entries (including fungi and algae), part 2406.
7230. gbpln2407.seq - Plant sequence entries (including fungi and algae), part 2407.
7231. gbpln2408.seq - Plant sequence entries (including fungi and algae), part 2408.
7232. gbpln2409.seq - Plant sequence entries (including fungi and algae), part 2409.
7233. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
7234. gbpln2410.seq - Plant sequence entries (including fungi and algae), part 2410.
7235. gbpln2411.seq - Plant sequence entries (including fungi and algae), part 2411.
7236. gbpln2412.seq - Plant sequence entries (including fungi and algae), part 2412.
7237. gbpln2413.seq - Plant sequence entries (including fungi and algae), part 2413.
7238. gbpln2414.seq - Plant sequence entries (including fungi and algae), part 2414.
7239. gbpln2415.seq - Plant sequence entries (including fungi and algae), part 2415.
7240. gbpln2416.seq - Plant sequence entries (including fungi and algae), part 2416.
7241. gbpln2417.seq - Plant sequence entries (including fungi and algae), part 2417.
7242. gbpln2418.seq - Plant sequence entries (including fungi and algae), part 2418.
7243. gbpln2419.seq - Plant sequence entries (including fungi and algae), part 2419.
7244. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
7245. gbpln2420.seq - Plant sequence entries (including fungi and algae), part 2420.
7246. gbpln2421.seq - Plant sequence entries (including fungi and algae), part 2421.
7247. gbpln2422.seq - Plant sequence entries (including fungi and algae), part 2422.
7248. gbpln2423.seq - Plant sequence entries (including fungi and algae), part 2423.
7249. gbpln2424.seq - Plant sequence entries (including fungi and algae), part 2424.
7250. gbpln2425.seq - Plant sequence entries (including fungi and algae), part 2425.
7251. gbpln2426.seq - Plant sequence entries (including fungi and algae), part 2426.
7252. gbpln2427.seq - Plant sequence entries (including fungi and algae), part 2427.
7253. gbpln2428.seq - Plant sequence entries (including fungi and algae), part 2428.
7254. gbpln2429.seq - Plant sequence entries (including fungi and algae), part 2429.
7255. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
7256. gbpln2430.seq - Plant sequence entries (including fungi and algae), part 2430.
7257. gbpln2431.seq - Plant sequence entries (including fungi and algae), part 2431.
7258. gbpln2432.seq - Plant sequence entries (including fungi and algae), part 2432.
7259. gbpln2433.seq - Plant sequence entries (including fungi and algae), part 2433.
7260. gbpln2434.seq - Plant sequence entries (including fungi and algae), part 2434.
7261. gbpln2435.seq - Plant sequence entries (including fungi and algae), part 2435.
7262. gbpln2436.seq - Plant sequence entries (including fungi and algae), part 2436.
7263. gbpln2437.seq - Plant sequence entries (including fungi and algae), part 2437.
7264. gbpln2438.seq - Plant sequence entries (including fungi and algae), part 2438.
7265. gbpln2439.seq - Plant sequence entries (including fungi and algae), part 2439.
7266. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
7267. gbpln2440.seq - Plant sequence entries (including fungi and algae), part 2440.
7268. gbpln2441.seq - Plant sequence entries (including fungi and algae), part 2441.
7269. gbpln2442.seq - Plant sequence entries (including fungi and algae), part 2442.
7270. gbpln2443.seq - Plant sequence entries (including fungi and algae), part 2443.
7271. gbpln2444.seq - Plant sequence entries (including fungi and algae), part 2444.
7272. gbpln2445.seq - Plant sequence entries (including fungi and algae), part 2445.
7273. gbpln2446.seq - Plant sequence entries (including fungi and algae), part 2446.
7274. gbpln2447.seq - Plant sequence entries (including fungi and algae), part 2447.
7275. gbpln2448.seq - Plant sequence entries (including fungi and algae), part 2448.
7276. gbpln2449.seq - Plant sequence entries (including fungi and algae), part 2449.
7277. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
7278. gbpln2450.seq - Plant sequence entries (including fungi and algae), part 2450.
7279. gbpln2451.seq - Plant sequence entries (including fungi and algae), part 2451.
7280. gbpln2452.seq - Plant sequence entries (including fungi and algae), part 2452.
7281. gbpln2453.seq - Plant sequence entries (including fungi and algae), part 2453.
7282. gbpln2454.seq - Plant sequence entries (including fungi and algae), part 2454.
7283. gbpln2455.seq - Plant sequence entries (including fungi and algae), part 2455.
7284. gbpln2456.seq - Plant sequence entries (including fungi and algae), part 2456.
7285. gbpln2457.seq - Plant sequence entries (including fungi and algae), part 2457.
7286. gbpln2458.seq - Plant sequence entries (including fungi and algae), part 2458.
7287. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
7288. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
7289. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
7290. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
7291. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
7292. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
7293. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
7294. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
7295. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
7296. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
7297. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
7298. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
7299. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
7300. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
7301. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
7302. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
7303. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
7304. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
7305. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
7306. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
7307. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
7308. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
7309. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
7310. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
7311. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
7312. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
7313. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
7314. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
7315. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
7316. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
7317. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
7318. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
7319. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
7320. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
7321. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
7322. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
7323. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
7324. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
7325. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
7326. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
7327. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
7328. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
7329. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
7330. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
7331. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
7332. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
7333. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
7334. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
7335. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
7336. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
7337. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
7338. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
7339. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
7340. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
7341. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
7342. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
7343. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
7344. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
7345. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
7346. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
7347. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
7348. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
7349. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
7350. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
7351. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
7352. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
7353. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
7354. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
7355. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
7356. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
7357. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
7358. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
7359. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
7360. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
7361. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
7362. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
7363. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
7364. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
7365. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
7366. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
7367. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
7368. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
7369. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
7370. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
7371. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
7372. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
7373. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
7374. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
7375. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
7376. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
7377. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
7378. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
7379. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
7380. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
7381. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
7382. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
7383. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
7384. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
7385. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
7386. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
7387. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
7388. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
7389. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
7390. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
7391. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
7392. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
7393. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
7394. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
7395. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
7396. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
7397. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
7398. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
7399. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
7400. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
7401. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
7402. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
7403. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
7404. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
7405. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
7406. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
7407. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
7408. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
7409. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
7410. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
7411. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
7412. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
7413. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
7414. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
7415. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
7416. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
7417. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
7418. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
7419. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
7420. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
7421. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
7422. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
7423. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
7424. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
7425. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
7426. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
7427. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
7428. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
7429. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
7430. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
7431. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
7432. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
7433. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
7434. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
7435. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
7436. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
7437. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
7438. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
7439. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
7440. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
7441. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
7442. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
7443. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
7444. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
7445. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
7446. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
7447. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
7448. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
7449. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
7450. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
7451. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
7452. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
7453. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
7454. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
7455. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
7456. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
7457. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
7458. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
7459. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
7460. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
7461. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
7462. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
7463. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
7464. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
7465. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
7466. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
7467. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
7468. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
7469. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
7470. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
7471. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
7472. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
7473. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
7474. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
7475. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
7476. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
7477. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
7478. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
7479. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
7480. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
7481. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
7482. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
7483. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
7484. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
7485. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
7486. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
7487. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
7488. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
7489. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
7490. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
7491. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
7492. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
7493. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
7494. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
7495. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
7496. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
7497. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
7498. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
7499. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
7500. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
7501. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
7502. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
7503. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
7504. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
7505. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
7506. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
7507. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
7508. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
7509. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
7510. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
7511. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
7512. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
7513. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
7514. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
7515. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
7516. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
7517. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
7518. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
7519. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
7520. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
7521. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
7522. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
7523. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
7524. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
7525. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
7526. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
7527. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
7528. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
7529. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
7530. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
7531. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
7532. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
7533. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
7534. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
7535. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
7536. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
7537. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
7538. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
7539. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
7540. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
7541. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
7542. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
7543. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
7544. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
7545. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
7546. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
7547. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
7548. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
7549. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
7550. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
7551. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
7552. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
7553. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
7554. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
7555. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
7556. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
7557. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
7558. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
7559. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
7560. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
7561. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
7562. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
7563. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
7564. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
7565. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
7566. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
7567. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
7568. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
7569. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
7570. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
7571. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
7572. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
7573. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
7574. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
7575. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
7576. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
7577. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
7578. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
7579. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
7580. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
7581. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
7582. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
7583. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
7584. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
7585. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
7586. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
7587. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
7588. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
7589. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
7590. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
7591. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
7592. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
7593. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
7594. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
7595. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
7596. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
7597. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
7598. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
7599. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
7600. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
7601. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
7602. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
7603. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
7604. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
7605. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
7606. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
7607. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
7608. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
7609. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
7610. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
7611. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
7612. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
7613. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
7614. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
7615. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
7616. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
7617. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
7618. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
7619. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
7620. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
7621. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
7622. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
7623. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
7624. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
7625. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
7626. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
7627. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
7628. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
7629. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
7630. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
7631. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
7632. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
7633. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
7634. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
7635. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
7636. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
7637. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
7638. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
7639. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
7640. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
7641. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
7642. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
7643. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
7644. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
7645. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
7646. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
7647. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
7648. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
7649. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
7650. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
7651. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
7652. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
7653. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
7654. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
7655. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
7656. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
7657. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
7658. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
7659. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
7660. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
7661. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
7662. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
7663. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
7664. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
7665. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
7666. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
7667. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
7668. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
7669. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
7670. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
7671. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
7672. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
7673. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
7674. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
7675. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
7676. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
7677. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
7678. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
7679. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
7680. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
7681. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
7682. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
7683. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
7684. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
7685. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
7686. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
7687. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
7688. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
7689. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
7690. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
7691. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
7692. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
7693. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
7694. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
7695. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
7696. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
7697. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
7698. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
7699. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
7700. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
7701. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
7702. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
7703. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
7704. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
7705. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
7706. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
7707. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
7708. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
7709. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
7710. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
7711. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
7712. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
7713. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
7714. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
7715. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
7716. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
7717. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
7718. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
7719. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
7720. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
7721. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
7722. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
7723. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
7724. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
7725. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
7726. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
7727. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
7728. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
7729. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
7730. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
7731. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
7732. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
7733. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
7734. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
7735. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
7736. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
7737. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
7738. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
7739. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
7740. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
7741. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
7742. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
7743. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
7744. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
7745. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
7746. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
7747. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
7748. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
7749. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
7750. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
7751. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
7752. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
7753. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
7754. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
7755. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
7756. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
7757. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
7758. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
7759. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
7760. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
7761. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
7762. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
7763. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
7764. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
7765. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
7766. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
7767. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
7768. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
7769. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
7770. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
7771. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
7772. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
7773. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
7774. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
7775. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
7776. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
7777. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
7778. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
7779. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
7780. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
7781. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
7782. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
7783. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
7784. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
7785. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
7786. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
7787. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
7788. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
7789. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
7790. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
7791. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
7792. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
7793. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
7794. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
7795. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
7796. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
7797. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
7798. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
7799. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
7800. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
7801. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
7802. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
7803. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
7804. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
7805. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
7806. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
7807. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
7808. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
7809. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
7810. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
7811. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
7812. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
7813. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
7814. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
7815. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
7816. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
7817. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
7818. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
7819. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
7820. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
7821. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
7822. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
7823. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
7824. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
7825. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
7826. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
7827. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
7828. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
7829. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
7830. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
7831. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
7832. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
7833. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
7834. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
7835. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
7836. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
7837. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
7838. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
7839. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
7840. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
7841. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
7842. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
7843. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
7844. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
7845. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
7846. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
7847. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
7848. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
7849. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
7850. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
7851. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
7852. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
7853. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
7854. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
7855. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
7856. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
7857. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
7858. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
7859. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
7860. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
7861. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
7862. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
7863. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
7864. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
7865. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
7866. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
7867. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
7868. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
7869. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
7870. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
7871. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
7872. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
7873. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
7874. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
7875. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
7876. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
7877. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
7878. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
7879. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
7880. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
7881. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
7882. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
7883. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
7884. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
7885. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
7886. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
7887. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
7888. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
7889. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
7890. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
7891. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
7892. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
7893. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
7894. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
7895. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
7896. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
7897. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
7898. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
7899. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
7900. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
7901. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
7902. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
7903. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
7904. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
7905. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
7906. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
7907. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
7908. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
7909. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
7910. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
7911. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
7912. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
7913. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
7914. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
7915. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
7916. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
7917. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
7918. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
7919. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
7920. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
7921. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
7922. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
7923. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
7924. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
7925. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
7926. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
7927. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
7928. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
7929. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
7930. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
7931. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
7932. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
7933. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
7934. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
7935. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
7936. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
7937. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
7938. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
7939. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
7940. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
7941. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
7942. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
7943. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
7944. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
7945. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
7946. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
7947. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
7948. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
7949. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
7950. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
7951. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
7952. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
7953. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
7954. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
7955. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
7956. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
7957. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
7958. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
7959. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
7960. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
7961. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
7962. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
7963. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
7964. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
7965. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
7966. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
7967. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
7968. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
7969. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
7970. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
7971. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
7972. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
7973. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
7974. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
7975. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
7976. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
7977. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
7978. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
7979. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
7980. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
7981. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
7982. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
7983. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
7984. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
7985. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
7986. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
7987. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
7988. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
7989. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
7990. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
7991. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
7992. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
7993. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
7994. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
7995. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
7996. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
7997. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
7998. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
7999. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
8000. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
8001. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
8002. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
8003. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
8004. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
8005. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
8006. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
8007. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
8008. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
8009. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
8010. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
8011. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
8012. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
8013. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
8014. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
8015. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
8016. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
8017. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
8018. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
8019. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
8020. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
8021. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
8022. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
8023. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
8024. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
8025. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
8026. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
8027. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
8028. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
8029. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
8030. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
8031. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
8032. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
8033. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
8034. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
8035. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
8036. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
8037. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
8038. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
8039. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
8040. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
8041. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
8042. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
8043. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
8044. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
8045. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
8046. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
8047. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
8048. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
8049. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
8050. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
8051. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
8052. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
8053. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
8054. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
8055. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
8056. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
8057. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
8058. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
8059. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
8060. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
8061. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
8062. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
8063. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
8064. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
8065. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
8066. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
8067. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
8068. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
8069. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
8070. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
8071. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
8072. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
8073. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
8074. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
8075. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
8076. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
8077. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
8078. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
8079. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
8080. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
8081. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
8082. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
8083. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
8084. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
8085. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
8086. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
8087. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
8088. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
8089. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
8090. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
8091. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
8092. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
8093. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
8094. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
8095. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
8096. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
8097. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
8098. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
8099. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
8100. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
8101. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
8102. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
8103. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
8104. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
8105. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
8106. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
8107. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
8108. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
8109. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
8110. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
8111. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
8112. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
8113. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
8114. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
8115. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
8116. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
8117. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
8118. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
8119. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
8120. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
8121. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
8122. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
8123. gbpri1.seq - Primate sequence entries, part 1.
8124. gbpri10.seq - Primate sequence entries, part 10.
8125. gbpri11.seq - Primate sequence entries, part 11.
8126. gbpri12.seq - Primate sequence entries, part 12.
8127. gbpri13.seq - Primate sequence entries, part 13.
8128. gbpri14.seq - Primate sequence entries, part 14.
8129. gbpri15.seq - Primate sequence entries, part 15.
8130. gbpri16.seq - Primate sequence entries, part 16.
8131. gbpri17.seq - Primate sequence entries, part 17.
8132. gbpri18.seq - Primate sequence entries, part 18.
8133. gbpri19.seq - Primate sequence entries, part 19.
8134. gbpri2.seq - Primate sequence entries, part 2.
8135. gbpri20.seq - Primate sequence entries, part 20.
8136. gbpri21.seq - Primate sequence entries, part 21.
8137. gbpri22.seq - Primate sequence entries, part 22.
8138. gbpri23.seq - Primate sequence entries, part 23.
8139. gbpri24.seq - Primate sequence entries, part 24.
8140. gbpri25.seq - Primate sequence entries, part 25.
8141. gbpri26.seq - Primate sequence entries, part 26.
8142. gbpri27.seq - Primate sequence entries, part 27.
8143. gbpri28.seq - Primate sequence entries, part 28.
8144. gbpri29.seq - Primate sequence entries, part 29.
8145. gbpri3.seq - Primate sequence entries, part 3.
8146. gbpri30.seq - Primate sequence entries, part 30.
8147. gbpri31.seq - Primate sequence entries, part 31.
8148. gbpri32.seq - Primate sequence entries, part 32.
8149. gbpri33.seq - Primate sequence entries, part 33.
8150. gbpri34.seq - Primate sequence entries, part 34.
8151. gbpri35.seq - Primate sequence entries, part 35.
8152. gbpri36.seq - Primate sequence entries, part 36.
8153. gbpri37.seq - Primate sequence entries, part 37.
8154. gbpri38.seq - Primate sequence entries, part 38.
8155. gbpri39.seq - Primate sequence entries, part 39.
8156. gbpri4.seq - Primate sequence entries, part 4.
8157. gbpri40.seq - Primate sequence entries, part 40.
8158. gbpri41.seq - Primate sequence entries, part 41.
8159. gbpri42.seq - Primate sequence entries, part 42.
8160. gbpri43.seq - Primate sequence entries, part 43.
8161. gbpri44.seq - Primate sequence entries, part 44.
8162. gbpri45.seq - Primate sequence entries, part 45.
8163. gbpri46.seq - Primate sequence entries, part 46.
8164. gbpri47.seq - Primate sequence entries, part 47.
8165. gbpri48.seq - Primate sequence entries, part 48.
8166. gbpri49.seq - Primate sequence entries, part 49.
8167. gbpri5.seq - Primate sequence entries, part 5.
8168. gbpri50.seq - Primate sequence entries, part 50.
8169. gbpri51.seq - Primate sequence entries, part 51.
8170. gbpri52.seq - Primate sequence entries, part 52.
8171. gbpri53.seq - Primate sequence entries, part 53.
8172. gbpri54.seq - Primate sequence entries, part 54.
8173. gbpri55.seq - Primate sequence entries, part 55.
8174. gbpri56.seq - Primate sequence entries, part 56.
8175. gbpri57.seq - Primate sequence entries, part 57.
8176. gbpri58.seq - Primate sequence entries, part 58.
8177. gbpri59.seq - Primate sequence entries, part 59.
8178. gbpri6.seq - Primate sequence entries, part 6.
8179. gbpri60.seq - Primate sequence entries, part 60.
8180. gbpri61.seq - Primate sequence entries, part 61.
8181. gbpri62.seq - Primate sequence entries, part 62.
8182. gbpri63.seq - Primate sequence entries, part 63.
8183. gbpri64.seq - Primate sequence entries, part 64.
8184. gbpri65.seq - Primate sequence entries, part 65.
8185. gbpri66.seq - Primate sequence entries, part 66.
8186. gbpri67.seq - Primate sequence entries, part 67.
8187. gbpri68.seq - Primate sequence entries, part 68.
8188. gbpri69.seq - Primate sequence entries, part 69.
8189. gbpri7.seq - Primate sequence entries, part 7.
8190. gbpri70.seq - Primate sequence entries, part 70.
8191. gbpri71.seq - Primate sequence entries, part 71.
8192. gbpri72.seq - Primate sequence entries, part 72.
8193. gbpri73.seq - Primate sequence entries, part 73.
8194. gbpri74.seq - Primate sequence entries, part 74.
8195. gbpri75.seq - Primate sequence entries, part 75.
8196. gbpri76.seq - Primate sequence entries, part 76.
8197. gbpri77.seq - Primate sequence entries, part 77.
8198. gbpri78.seq - Primate sequence entries, part 78.
8199. gbpri79.seq - Primate sequence entries, part 79.
8200. gbpri8.seq - Primate sequence entries, part 8.
8201. gbpri80.seq - Primate sequence entries, part 80.
8202. gbpri81.seq - Primate sequence entries, part 81.
8203. gbpri82.seq - Primate sequence entries, part 82.
8204. gbpri83.seq - Primate sequence entries, part 83.
8205. gbpri84.seq - Primate sequence entries, part 84.
8206. gbpri85.seq - Primate sequence entries, part 85.
8207. gbpri86.seq - Primate sequence entries, part 86.
8208. gbpri87.seq - Primate sequence entries, part 87.
8209. gbpri9.seq - Primate sequence entries, part 9.
8210. gbrel.txt - Release notes (this document).
8211. gbrod1.seq - Rodent sequence entries, part 1.
8212. gbrod10.seq - Rodent sequence entries, part 10.
8213. gbrod100.seq - Rodent sequence entries, part 100.
8214. gbrod101.seq - Rodent sequence entries, part 101.
8215. gbrod102.seq - Rodent sequence entries, part 102.
8216. gbrod103.seq - Rodent sequence entries, part 103.
8217. gbrod104.seq - Rodent sequence entries, part 104.
8218. gbrod105.seq - Rodent sequence entries, part 105.
8219. gbrod106.seq - Rodent sequence entries, part 106.
8220. gbrod107.seq - Rodent sequence entries, part 107.
8221. gbrod108.seq - Rodent sequence entries, part 108.
8222. gbrod109.seq - Rodent sequence entries, part 109.
8223. gbrod11.seq - Rodent sequence entries, part 11.
8224. gbrod110.seq - Rodent sequence entries, part 110.
8225. gbrod111.seq - Rodent sequence entries, part 111.
8226. gbrod112.seq - Rodent sequence entries, part 112.
8227. gbrod113.seq - Rodent sequence entries, part 113.
8228. gbrod114.seq - Rodent sequence entries, part 114.
8229. gbrod115.seq - Rodent sequence entries, part 115.
8230. gbrod116.seq - Rodent sequence entries, part 116.
8231. gbrod117.seq - Rodent sequence entries, part 117.
8232. gbrod118.seq - Rodent sequence entries, part 118.
8233. gbrod119.seq - Rodent sequence entries, part 119.
8234. gbrod12.seq - Rodent sequence entries, part 12.
8235. gbrod120.seq - Rodent sequence entries, part 120.
8236. gbrod121.seq - Rodent sequence entries, part 121.
8237. gbrod122.seq - Rodent sequence entries, part 122.
8238. gbrod123.seq - Rodent sequence entries, part 123.
8239. gbrod124.seq - Rodent sequence entries, part 124.
8240. gbrod125.seq - Rodent sequence entries, part 125.
8241. gbrod126.seq - Rodent sequence entries, part 126.
8242. gbrod127.seq - Rodent sequence entries, part 127.
8243. gbrod128.seq - Rodent sequence entries, part 128.
8244. gbrod129.seq - Rodent sequence entries, part 129.
8245. gbrod13.seq - Rodent sequence entries, part 13.
8246. gbrod130.seq - Rodent sequence entries, part 130.
8247. gbrod131.seq - Rodent sequence entries, part 131.
8248. gbrod132.seq - Rodent sequence entries, part 132.
8249. gbrod133.seq - Rodent sequence entries, part 133.
8250. gbrod134.seq - Rodent sequence entries, part 134.
8251. gbrod135.seq - Rodent sequence entries, part 135.
8252. gbrod136.seq - Rodent sequence entries, part 136.
8253. gbrod137.seq - Rodent sequence entries, part 137.
8254. gbrod138.seq - Rodent sequence entries, part 138.
8255. gbrod139.seq - Rodent sequence entries, part 139.
8256. gbrod14.seq - Rodent sequence entries, part 14.
8257. gbrod140.seq - Rodent sequence entries, part 140.
8258. gbrod141.seq - Rodent sequence entries, part 141.
8259. gbrod142.seq - Rodent sequence entries, part 142.
8260. gbrod143.seq - Rodent sequence entries, part 143.
8261. gbrod144.seq - Rodent sequence entries, part 144.
8262. gbrod145.seq - Rodent sequence entries, part 145.
8263. gbrod146.seq - Rodent sequence entries, part 146.
8264. gbrod147.seq - Rodent sequence entries, part 147.
8265. gbrod148.seq - Rodent sequence entries, part 148.
8266. gbrod149.seq - Rodent sequence entries, part 149.
8267. gbrod15.seq - Rodent sequence entries, part 15.
8268. gbrod150.seq - Rodent sequence entries, part 150.
8269. gbrod151.seq - Rodent sequence entries, part 151.
8270. gbrod152.seq - Rodent sequence entries, part 152.
8271. gbrod153.seq - Rodent sequence entries, part 153.
8272. gbrod154.seq - Rodent sequence entries, part 154.
8273. gbrod155.seq - Rodent sequence entries, part 155.
8274. gbrod156.seq - Rodent sequence entries, part 156.
8275. gbrod157.seq - Rodent sequence entries, part 157.
8276. gbrod158.seq - Rodent sequence entries, part 158.
8277. gbrod159.seq - Rodent sequence entries, part 159.
8278. gbrod16.seq - Rodent sequence entries, part 16.
8279. gbrod160.seq - Rodent sequence entries, part 160.
8280. gbrod161.seq - Rodent sequence entries, part 161.
8281. gbrod162.seq - Rodent sequence entries, part 162.
8282. gbrod163.seq - Rodent sequence entries, part 163.
8283. gbrod164.seq - Rodent sequence entries, part 164.
8284. gbrod165.seq - Rodent sequence entries, part 165.
8285. gbrod166.seq - Rodent sequence entries, part 166.
8286. gbrod167.seq - Rodent sequence entries, part 167.
8287. gbrod168.seq - Rodent sequence entries, part 168.
8288. gbrod169.seq - Rodent sequence entries, part 169.
8289. gbrod17.seq - Rodent sequence entries, part 17.
8290. gbrod170.seq - Rodent sequence entries, part 170.
8291. gbrod171.seq - Rodent sequence entries, part 171.
8292. gbrod172.seq - Rodent sequence entries, part 172.
8293. gbrod173.seq - Rodent sequence entries, part 173.
8294. gbrod174.seq - Rodent sequence entries, part 174.
8295. gbrod175.seq - Rodent sequence entries, part 175.
8296. gbrod176.seq - Rodent sequence entries, part 176.
8297. gbrod177.seq - Rodent sequence entries, part 177.
8298. gbrod178.seq - Rodent sequence entries, part 178.
8299. gbrod179.seq - Rodent sequence entries, part 179.
8300. gbrod18.seq - Rodent sequence entries, part 18.
8301. gbrod180.seq - Rodent sequence entries, part 180.
8302. gbrod181.seq - Rodent sequence entries, part 181.
8303. gbrod182.seq - Rodent sequence entries, part 182.
8304. gbrod183.seq - Rodent sequence entries, part 183.
8305. gbrod184.seq - Rodent sequence entries, part 184.
8306. gbrod185.seq - Rodent sequence entries, part 185.
8307. gbrod186.seq - Rodent sequence entries, part 186.
8308. gbrod187.seq - Rodent sequence entries, part 187.
8309. gbrod188.seq - Rodent sequence entries, part 188.
8310. gbrod189.seq - Rodent sequence entries, part 189.
8311. gbrod19.seq - Rodent sequence entries, part 19.
8312. gbrod190.seq - Rodent sequence entries, part 190.
8313. gbrod191.seq - Rodent sequence entries, part 191.
8314. gbrod192.seq - Rodent sequence entries, part 192.
8315. gbrod193.seq - Rodent sequence entries, part 193.
8316. gbrod194.seq - Rodent sequence entries, part 194.
8317. gbrod195.seq - Rodent sequence entries, part 195.
8318. gbrod196.seq - Rodent sequence entries, part 196.
8319. gbrod197.seq - Rodent sequence entries, part 197.
8320. gbrod198.seq - Rodent sequence entries, part 198.
8321. gbrod199.seq - Rodent sequence entries, part 199.
8322. gbrod2.seq - Rodent sequence entries, part 2.
8323. gbrod20.seq - Rodent sequence entries, part 20.
8324. gbrod200.seq - Rodent sequence entries, part 200.
8325. gbrod201.seq - Rodent sequence entries, part 201.
8326. gbrod202.seq - Rodent sequence entries, part 202.
8327. gbrod203.seq - Rodent sequence entries, part 203.
8328. gbrod204.seq - Rodent sequence entries, part 204.
8329. gbrod205.seq - Rodent sequence entries, part 205.
8330. gbrod206.seq - Rodent sequence entries, part 206.
8331. gbrod207.seq - Rodent sequence entries, part 207.
8332. gbrod208.seq - Rodent sequence entries, part 208.
8333. gbrod209.seq - Rodent sequence entries, part 209.
8334. gbrod21.seq - Rodent sequence entries, part 21.
8335. gbrod210.seq - Rodent sequence entries, part 210.
8336. gbrod211.seq - Rodent sequence entries, part 211.
8337. gbrod212.seq - Rodent sequence entries, part 212.
8338. gbrod213.seq - Rodent sequence entries, part 213.
8339. gbrod214.seq - Rodent sequence entries, part 214.
8340. gbrod215.seq - Rodent sequence entries, part 215.
8341. gbrod216.seq - Rodent sequence entries, part 216.
8342. gbrod217.seq - Rodent sequence entries, part 217.
8343. gbrod218.seq - Rodent sequence entries, part 218.
8344. gbrod219.seq - Rodent sequence entries, part 219.
8345. gbrod22.seq - Rodent sequence entries, part 22.
8346. gbrod220.seq - Rodent sequence entries, part 220.
8347. gbrod221.seq - Rodent sequence entries, part 221.
8348. gbrod222.seq - Rodent sequence entries, part 222.
8349. gbrod223.seq - Rodent sequence entries, part 223.
8350. gbrod224.seq - Rodent sequence entries, part 224.
8351. gbrod225.seq - Rodent sequence entries, part 225.
8352. gbrod226.seq - Rodent sequence entries, part 226.
8353. gbrod227.seq - Rodent sequence entries, part 227.
8354. gbrod228.seq - Rodent sequence entries, part 228.
8355. gbrod229.seq - Rodent sequence entries, part 229.
8356. gbrod23.seq - Rodent sequence entries, part 23.
8357. gbrod230.seq - Rodent sequence entries, part 230.
8358. gbrod231.seq - Rodent sequence entries, part 231.
8359. gbrod232.seq - Rodent sequence entries, part 232.
8360. gbrod233.seq - Rodent sequence entries, part 233.
8361. gbrod234.seq - Rodent sequence entries, part 234.
8362. gbrod235.seq - Rodent sequence entries, part 235.
8363. gbrod236.seq - Rodent sequence entries, part 236.
8364. gbrod237.seq - Rodent sequence entries, part 237.
8365. gbrod238.seq - Rodent sequence entries, part 238.
8366. gbrod239.seq - Rodent sequence entries, part 239.
8367. gbrod24.seq - Rodent sequence entries, part 24.
8368. gbrod240.seq - Rodent sequence entries, part 240.
8369. gbrod241.seq - Rodent sequence entries, part 241.
8370. gbrod242.seq - Rodent sequence entries, part 242.
8371. gbrod243.seq - Rodent sequence entries, part 243.
8372. gbrod244.seq - Rodent sequence entries, part 244.
8373. gbrod245.seq - Rodent sequence entries, part 245.
8374. gbrod246.seq - Rodent sequence entries, part 246.
8375. gbrod247.seq - Rodent sequence entries, part 247.
8376. gbrod248.seq - Rodent sequence entries, part 248.
8377. gbrod249.seq - Rodent sequence entries, part 249.
8378. gbrod25.seq - Rodent sequence entries, part 25.
8379. gbrod250.seq - Rodent sequence entries, part 250.
8380. gbrod251.seq - Rodent sequence entries, part 251.
8381. gbrod252.seq - Rodent sequence entries, part 252.
8382. gbrod253.seq - Rodent sequence entries, part 253.
8383. gbrod254.seq - Rodent sequence entries, part 254.
8384. gbrod255.seq - Rodent sequence entries, part 255.
8385. gbrod256.seq - Rodent sequence entries, part 256.
8386. gbrod257.seq - Rodent sequence entries, part 257.
8387. gbrod258.seq - Rodent sequence entries, part 258.
8388. gbrod259.seq - Rodent sequence entries, part 259.
8389. gbrod26.seq - Rodent sequence entries, part 26.
8390. gbrod260.seq - Rodent sequence entries, part 260.
8391. gbrod261.seq - Rodent sequence entries, part 261.
8392. gbrod262.seq - Rodent sequence entries, part 262.
8393. gbrod263.seq - Rodent sequence entries, part 263.
8394. gbrod264.seq - Rodent sequence entries, part 264.
8395. gbrod265.seq - Rodent sequence entries, part 265.
8396. gbrod266.seq - Rodent sequence entries, part 266.
8397. gbrod267.seq - Rodent sequence entries, part 267.
8398. gbrod268.seq - Rodent sequence entries, part 268.
8399. gbrod269.seq - Rodent sequence entries, part 269.
8400. gbrod27.seq - Rodent sequence entries, part 27.
8401. gbrod270.seq - Rodent sequence entries, part 270.
8402. gbrod271.seq - Rodent sequence entries, part 271.
8403. gbrod272.seq - Rodent sequence entries, part 272.
8404. gbrod273.seq - Rodent sequence entries, part 273.
8405. gbrod274.seq - Rodent sequence entries, part 274.
8406. gbrod275.seq - Rodent sequence entries, part 275.
8407. gbrod276.seq - Rodent sequence entries, part 276.
8408. gbrod277.seq - Rodent sequence entries, part 277.
8409. gbrod278.seq - Rodent sequence entries, part 278.
8410. gbrod279.seq - Rodent sequence entries, part 279.
8411. gbrod28.seq - Rodent sequence entries, part 28.
8412. gbrod280.seq - Rodent sequence entries, part 280.
8413. gbrod281.seq - Rodent sequence entries, part 281.
8414. gbrod282.seq - Rodent sequence entries, part 282.
8415. gbrod283.seq - Rodent sequence entries, part 283.
8416. gbrod284.seq - Rodent sequence entries, part 284.
8417. gbrod285.seq - Rodent sequence entries, part 285.
8418. gbrod286.seq - Rodent sequence entries, part 286.
8419. gbrod287.seq - Rodent sequence entries, part 287.
8420. gbrod288.seq - Rodent sequence entries, part 288.
8421. gbrod289.seq - Rodent sequence entries, part 289.
8422. gbrod29.seq - Rodent sequence entries, part 29.
8423. gbrod290.seq - Rodent sequence entries, part 290.
8424. gbrod291.seq - Rodent sequence entries, part 291.
8425. gbrod292.seq - Rodent sequence entries, part 292.
8426. gbrod293.seq - Rodent sequence entries, part 293.
8427. gbrod294.seq - Rodent sequence entries, part 294.
8428. gbrod295.seq - Rodent sequence entries, part 295.
8429. gbrod296.seq - Rodent sequence entries, part 296.
8430. gbrod297.seq - Rodent sequence entries, part 297.
8431. gbrod298.seq - Rodent sequence entries, part 298.
8432. gbrod299.seq - Rodent sequence entries, part 299.
8433. gbrod3.seq - Rodent sequence entries, part 3.
8434. gbrod30.seq - Rodent sequence entries, part 30.
8435. gbrod300.seq - Rodent sequence entries, part 300.
8436. gbrod301.seq - Rodent sequence entries, part 301.
8437. gbrod302.seq - Rodent sequence entries, part 302.
8438. gbrod303.seq - Rodent sequence entries, part 303.
8439. gbrod304.seq - Rodent sequence entries, part 304.
8440. gbrod305.seq - Rodent sequence entries, part 305.
8441. gbrod306.seq - Rodent sequence entries, part 306.
8442. gbrod307.seq - Rodent sequence entries, part 307.
8443. gbrod308.seq - Rodent sequence entries, part 308.
8444. gbrod309.seq - Rodent sequence entries, part 309.
8445. gbrod31.seq - Rodent sequence entries, part 31.
8446. gbrod310.seq - Rodent sequence entries, part 310.
8447. gbrod311.seq - Rodent sequence entries, part 311.
8448. gbrod312.seq - Rodent sequence entries, part 312.
8449. gbrod313.seq - Rodent sequence entries, part 313.
8450. gbrod314.seq - Rodent sequence entries, part 314.
8451. gbrod315.seq - Rodent sequence entries, part 315.
8452. gbrod316.seq - Rodent sequence entries, part 316.
8453. gbrod317.seq - Rodent sequence entries, part 317.
8454. gbrod318.seq - Rodent sequence entries, part 318.
8455. gbrod319.seq - Rodent sequence entries, part 319.
8456. gbrod32.seq - Rodent sequence entries, part 32.
8457. gbrod320.seq - Rodent sequence entries, part 320.
8458. gbrod321.seq - Rodent sequence entries, part 321.
8459. gbrod322.seq - Rodent sequence entries, part 322.
8460. gbrod323.seq - Rodent sequence entries, part 323.
8461. gbrod324.seq - Rodent sequence entries, part 324.
8462. gbrod325.seq - Rodent sequence entries, part 325.
8463. gbrod326.seq - Rodent sequence entries, part 326.
8464. gbrod327.seq - Rodent sequence entries, part 327.
8465. gbrod328.seq - Rodent sequence entries, part 328.
8466. gbrod329.seq - Rodent sequence entries, part 329.
8467. gbrod33.seq - Rodent sequence entries, part 33.
8468. gbrod330.seq - Rodent sequence entries, part 330.
8469. gbrod331.seq - Rodent sequence entries, part 331.
8470. gbrod332.seq - Rodent sequence entries, part 332.
8471. gbrod333.seq - Rodent sequence entries, part 333.
8472. gbrod334.seq - Rodent sequence entries, part 334.
8473. gbrod335.seq - Rodent sequence entries, part 335.
8474. gbrod336.seq - Rodent sequence entries, part 336.
8475. gbrod337.seq - Rodent sequence entries, part 337.
8476. gbrod338.seq - Rodent sequence entries, part 338.
8477. gbrod339.seq - Rodent sequence entries, part 339.
8478. gbrod34.seq - Rodent sequence entries, part 34.
8479. gbrod340.seq - Rodent sequence entries, part 340.
8480. gbrod341.seq - Rodent sequence entries, part 341.
8481. gbrod342.seq - Rodent sequence entries, part 342.
8482. gbrod343.seq - Rodent sequence entries, part 343.
8483. gbrod35.seq - Rodent sequence entries, part 35.
8484. gbrod36.seq - Rodent sequence entries, part 36.
8485. gbrod37.seq - Rodent sequence entries, part 37.
8486. gbrod38.seq - Rodent sequence entries, part 38.
8487. gbrod39.seq - Rodent sequence entries, part 39.
8488. gbrod4.seq - Rodent sequence entries, part 4.
8489. gbrod40.seq - Rodent sequence entries, part 40.
8490. gbrod41.seq - Rodent sequence entries, part 41.
8491. gbrod42.seq - Rodent sequence entries, part 42.
8492. gbrod43.seq - Rodent sequence entries, part 43.
8493. gbrod44.seq - Rodent sequence entries, part 44.
8494. gbrod45.seq - Rodent sequence entries, part 45.
8495. gbrod46.seq - Rodent sequence entries, part 46.
8496. gbrod47.seq - Rodent sequence entries, part 47.
8497. gbrod48.seq - Rodent sequence entries, part 48.
8498. gbrod49.seq - Rodent sequence entries, part 49.
8499. gbrod5.seq - Rodent sequence entries, part 5.
8500. gbrod50.seq - Rodent sequence entries, part 50.
8501. gbrod51.seq - Rodent sequence entries, part 51.
8502. gbrod52.seq - Rodent sequence entries, part 52.
8503. gbrod53.seq - Rodent sequence entries, part 53.
8504. gbrod54.seq - Rodent sequence entries, part 54.
8505. gbrod55.seq - Rodent sequence entries, part 55.
8506. gbrod56.seq - Rodent sequence entries, part 56.
8507. gbrod57.seq - Rodent sequence entries, part 57.
8508. gbrod58.seq - Rodent sequence entries, part 58.
8509. gbrod59.seq - Rodent sequence entries, part 59.
8510. gbrod6.seq - Rodent sequence entries, part 6.
8511. gbrod60.seq - Rodent sequence entries, part 60.
8512. gbrod61.seq - Rodent sequence entries, part 61.
8513. gbrod62.seq - Rodent sequence entries, part 62.
8514. gbrod63.seq - Rodent sequence entries, part 63.
8515. gbrod64.seq - Rodent sequence entries, part 64.
8516. gbrod65.seq - Rodent sequence entries, part 65.
8517. gbrod66.seq - Rodent sequence entries, part 66.
8518. gbrod67.seq - Rodent sequence entries, part 67.
8519. gbrod68.seq - Rodent sequence entries, part 68.
8520. gbrod69.seq - Rodent sequence entries, part 69.
8521. gbrod7.seq - Rodent sequence entries, part 7.
8522. gbrod70.seq - Rodent sequence entries, part 70.
8523. gbrod71.seq - Rodent sequence entries, part 71.
8524. gbrod72.seq - Rodent sequence entries, part 72.
8525. gbrod73.seq - Rodent sequence entries, part 73.
8526. gbrod74.seq - Rodent sequence entries, part 74.
8527. gbrod75.seq - Rodent sequence entries, part 75.
8528. gbrod76.seq - Rodent sequence entries, part 76.
8529. gbrod77.seq - Rodent sequence entries, part 77.
8530. gbrod78.seq - Rodent sequence entries, part 78.
8531. gbrod79.seq - Rodent sequence entries, part 79.
8532. gbrod8.seq - Rodent sequence entries, part 8.
8533. gbrod80.seq - Rodent sequence entries, part 80.
8534. gbrod81.seq - Rodent sequence entries, part 81.
8535. gbrod82.seq - Rodent sequence entries, part 82.
8536. gbrod83.seq - Rodent sequence entries, part 83.
8537. gbrod84.seq - Rodent sequence entries, part 84.
8538. gbrod85.seq - Rodent sequence entries, part 85.
8539. gbrod86.seq - Rodent sequence entries, part 86.
8540. gbrod87.seq - Rodent sequence entries, part 87.
8541. gbrod88.seq - Rodent sequence entries, part 88.
8542. gbrod89.seq - Rodent sequence entries, part 89.
8543. gbrod9.seq - Rodent sequence entries, part 9.
8544. gbrod90.seq - Rodent sequence entries, part 90.
8545. gbrod91.seq - Rodent sequence entries, part 91.
8546. gbrod92.seq - Rodent sequence entries, part 92.
8547. gbrod93.seq - Rodent sequence entries, part 93.
8548. gbrod94.seq - Rodent sequence entries, part 94.
8549. gbrod95.seq - Rodent sequence entries, part 95.
8550. gbrod96.seq - Rodent sequence entries, part 96.
8551. gbrod97.seq - Rodent sequence entries, part 97.
8552. gbrod98.seq - Rodent sequence entries, part 98.
8553. gbrod99.seq - Rodent sequence entries, part 99.
8554. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
8555. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
8556. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
8557. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
8558. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
8559. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
8560. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
8561. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
8562. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
8563. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
8564. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
8565. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
8566. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
8567. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
8568. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
8569. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
8570. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
8571. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
8572. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
8573. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
8574. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
8575. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
8576. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
8577. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
8578. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
8579. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
8580. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
8581. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
8582. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
8583. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
8584. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
8585. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
8586. gbsyn29.seq - Synthetic and chimeric sequence entries, part 29.
8587. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
8588. gbsyn30.seq - Synthetic and chimeric sequence entries, part 30.
8589. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
8590. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
8591. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
8592. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
8593. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
8594. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
8595. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
8596. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
8597. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
8598. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
8599. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
8600. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
8601. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
8602. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
8603. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
8604. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
8605. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
8606. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
8607. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
8608. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
8609. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
8610. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
8611. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
8612. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
8613. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
8614. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
8615. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
8616. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
8617. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
8618. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
8619. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
8620. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
8621. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
8622. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
8623. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
8624. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
8625. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
8626. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
8627. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
8628. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
8629. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
8630. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
8631. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
8632. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
8633. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
8634. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
8635. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
8636. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
8637. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
8638. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
8639. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
8640. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
8641. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
8642. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
8643. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
8644. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
8645. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
8646. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
8647. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
8648. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
8649. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
8650. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
8651. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
8652. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
8653. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
8654. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
8655. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
8656. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
8657. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
8658. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
8659. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
8660. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
8661. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
8662. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
8663. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
8664. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
8665. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
8666. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
8667. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
8668. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
8669. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
8670. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
8671. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
8672. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
8673. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
8674. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
8675. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
8676. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
8677. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
8678. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
8679. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
8680. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
8681. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
8682. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
8683. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
8684. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
8685. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
8686. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
8687. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
8688. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
8689. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
8690. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
8691. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
8692. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
8693. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
8694. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
8695. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
8696. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
8697. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
8698. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
8699. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
8700. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
8701. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
8702. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
8703. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
8704. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
8705. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
8706. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
8707. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
8708. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
8709. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
8710. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
8711. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
8712. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
8713. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
8714. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
8715. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
8716. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
8717. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
8718. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
8719. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
8720. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
8721. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
8722. gbuna1.seq - Unannotated sequence entries, part 1.
8723. gbvrl1.seq - Viral sequence entries, part 1.
8724. gbvrl10.seq - Viral sequence entries, part 10.
8725. gbvrl100.seq - Viral sequence entries, part 100.
8726. gbvrl1000.seq - Viral sequence entries, part 1000.
8727. gbvrl1001.seq - Viral sequence entries, part 1001.
8728. gbvrl1002.seq - Viral sequence entries, part 1002.
8729. gbvrl1003.seq - Viral sequence entries, part 1003.
8730. gbvrl1004.seq - Viral sequence entries, part 1004.
8731. gbvrl1005.seq - Viral sequence entries, part 1005.
8732. gbvrl1006.seq - Viral sequence entries, part 1006.
8733. gbvrl1007.seq - Viral sequence entries, part 1007.
8734. gbvrl1008.seq - Viral sequence entries, part 1008.
8735. gbvrl1009.seq - Viral sequence entries, part 1009.
8736. gbvrl101.seq - Viral sequence entries, part 101.
8737. gbvrl1010.seq - Viral sequence entries, part 1010.
8738. gbvrl1011.seq - Viral sequence entries, part 1011.
8739. gbvrl1012.seq - Viral sequence entries, part 1012.
8740. gbvrl1013.seq - Viral sequence entries, part 1013.
8741. gbvrl1014.seq - Viral sequence entries, part 1014.
8742. gbvrl1015.seq - Viral sequence entries, part 1015.
8743. gbvrl1016.seq - Viral sequence entries, part 1016.
8744. gbvrl1017.seq - Viral sequence entries, part 1017.
8745. gbvrl1018.seq - Viral sequence entries, part 1018.
8746. gbvrl1019.seq - Viral sequence entries, part 1019.
8747. gbvrl102.seq - Viral sequence entries, part 102.
8748. gbvrl1020.seq - Viral sequence entries, part 1020.
8749. gbvrl1021.seq - Viral sequence entries, part 1021.
8750. gbvrl1022.seq - Viral sequence entries, part 1022.
8751. gbvrl1023.seq - Viral sequence entries, part 1023.
8752. gbvrl1024.seq - Viral sequence entries, part 1024.
8753. gbvrl1025.seq - Viral sequence entries, part 1025.
8754. gbvrl1026.seq - Viral sequence entries, part 1026.
8755. gbvrl1027.seq - Viral sequence entries, part 1027.
8756. gbvrl1028.seq - Viral sequence entries, part 1028.
8757. gbvrl1029.seq - Viral sequence entries, part 1029.
8758. gbvrl103.seq - Viral sequence entries, part 103.
8759. gbvrl1030.seq - Viral sequence entries, part 1030.
8760. gbvrl1031.seq - Viral sequence entries, part 1031.
8761. gbvrl1032.seq - Viral sequence entries, part 1032.
8762. gbvrl1033.seq - Viral sequence entries, part 1033.
8763. gbvrl1034.seq - Viral sequence entries, part 1034.
8764. gbvrl1035.seq - Viral sequence entries, part 1035.
8765. gbvrl1036.seq - Viral sequence entries, part 1036.
8766. gbvrl1037.seq - Viral sequence entries, part 1037.
8767. gbvrl1038.seq - Viral sequence entries, part 1038.
8768. gbvrl1039.seq - Viral sequence entries, part 1039.
8769. gbvrl104.seq - Viral sequence entries, part 104.
8770. gbvrl1040.seq - Viral sequence entries, part 1040.
8771. gbvrl1041.seq - Viral sequence entries, part 1041.
8772. gbvrl1042.seq - Viral sequence entries, part 1042.
8773. gbvrl1043.seq - Viral sequence entries, part 1043.
8774. gbvrl1044.seq - Viral sequence entries, part 1044.
8775. gbvrl1045.seq - Viral sequence entries, part 1045.
8776. gbvrl1046.seq - Viral sequence entries, part 1046.
8777. gbvrl1047.seq - Viral sequence entries, part 1047.
8778. gbvrl1048.seq - Viral sequence entries, part 1048.
8779. gbvrl1049.seq - Viral sequence entries, part 1049.
8780. gbvrl105.seq - Viral sequence entries, part 105.
8781. gbvrl1050.seq - Viral sequence entries, part 1050.
8782. gbvrl1051.seq - Viral sequence entries, part 1051.
8783. gbvrl1052.seq - Viral sequence entries, part 1052.
8784. gbvrl1053.seq - Viral sequence entries, part 1053.
8785. gbvrl1054.seq - Viral sequence entries, part 1054.
8786. gbvrl1055.seq - Viral sequence entries, part 1055.
8787. gbvrl1056.seq - Viral sequence entries, part 1056.
8788. gbvrl1057.seq - Viral sequence entries, part 1057.
8789. gbvrl1058.seq - Viral sequence entries, part 1058.
8790. gbvrl1059.seq - Viral sequence entries, part 1059.
8791. gbvrl106.seq - Viral sequence entries, part 106.
8792. gbvrl1060.seq - Viral sequence entries, part 1060.
8793. gbvrl1061.seq - Viral sequence entries, part 1061.
8794. gbvrl1062.seq - Viral sequence entries, part 1062.
8795. gbvrl1063.seq - Viral sequence entries, part 1063.
8796. gbvrl1064.seq - Viral sequence entries, part 1064.
8797. gbvrl1065.seq - Viral sequence entries, part 1065.
8798. gbvrl1066.seq - Viral sequence entries, part 1066.
8799. gbvrl1067.seq - Viral sequence entries, part 1067.
8800. gbvrl1068.seq - Viral sequence entries, part 1068.
8801. gbvrl1069.seq - Viral sequence entries, part 1069.
8802. gbvrl107.seq - Viral sequence entries, part 107.
8803. gbvrl1070.seq - Viral sequence entries, part 1070.
8804. gbvrl1071.seq - Viral sequence entries, part 1071.
8805. gbvrl1072.seq - Viral sequence entries, part 1072.
8806. gbvrl1073.seq - Viral sequence entries, part 1073.
8807. gbvrl1074.seq - Viral sequence entries, part 1074.
8808. gbvrl1075.seq - Viral sequence entries, part 1075.
8809. gbvrl1076.seq - Viral sequence entries, part 1076.
8810. gbvrl1077.seq - Viral sequence entries, part 1077.
8811. gbvrl1078.seq - Viral sequence entries, part 1078.
8812. gbvrl1079.seq - Viral sequence entries, part 1079.
8813. gbvrl108.seq - Viral sequence entries, part 108.
8814. gbvrl1080.seq - Viral sequence entries, part 1080.
8815. gbvrl1081.seq - Viral sequence entries, part 1081.
8816. gbvrl1082.seq - Viral sequence entries, part 1082.
8817. gbvrl1083.seq - Viral sequence entries, part 1083.
8818. gbvrl1084.seq - Viral sequence entries, part 1084.
8819. gbvrl1085.seq - Viral sequence entries, part 1085.
8820. gbvrl1086.seq - Viral sequence entries, part 1086.
8821. gbvrl1087.seq - Viral sequence entries, part 1087.
8822. gbvrl1088.seq - Viral sequence entries, part 1088.
8823. gbvrl1089.seq - Viral sequence entries, part 1089.
8824. gbvrl109.seq - Viral sequence entries, part 109.
8825. gbvrl1090.seq - Viral sequence entries, part 1090.
8826. gbvrl1091.seq - Viral sequence entries, part 1091.
8827. gbvrl1092.seq - Viral sequence entries, part 1092.
8828. gbvrl1093.seq - Viral sequence entries, part 1093.
8829. gbvrl1094.seq - Viral sequence entries, part 1094.
8830. gbvrl1095.seq - Viral sequence entries, part 1095.
8831. gbvrl11.seq - Viral sequence entries, part 11.
8832. gbvrl110.seq - Viral sequence entries, part 110.
8833. gbvrl111.seq - Viral sequence entries, part 111.
8834. gbvrl112.seq - Viral sequence entries, part 112.
8835. gbvrl113.seq - Viral sequence entries, part 113.
8836. gbvrl114.seq - Viral sequence entries, part 114.
8837. gbvrl115.seq - Viral sequence entries, part 115.
8838. gbvrl116.seq - Viral sequence entries, part 116.
8839. gbvrl117.seq - Viral sequence entries, part 117.
8840. gbvrl118.seq - Viral sequence entries, part 118.
8841. gbvrl119.seq - Viral sequence entries, part 119.
8842. gbvrl12.seq - Viral sequence entries, part 12.
8843. gbvrl120.seq - Viral sequence entries, part 120.
8844. gbvrl121.seq - Viral sequence entries, part 121.
8845. gbvrl122.seq - Viral sequence entries, part 122.
8846. gbvrl123.seq - Viral sequence entries, part 123.
8847. gbvrl124.seq - Viral sequence entries, part 124.
8848. gbvrl125.seq - Viral sequence entries, part 125.
8849. gbvrl126.seq - Viral sequence entries, part 126.
8850. gbvrl127.seq - Viral sequence entries, part 127.
8851. gbvrl128.seq - Viral sequence entries, part 128.
8852. gbvrl129.seq - Viral sequence entries, part 129.
8853. gbvrl13.seq - Viral sequence entries, part 13.
8854. gbvrl130.seq - Viral sequence entries, part 130.
8855. gbvrl131.seq - Viral sequence entries, part 131.
8856. gbvrl132.seq - Viral sequence entries, part 132.
8857. gbvrl133.seq - Viral sequence entries, part 133.
8858. gbvrl134.seq - Viral sequence entries, part 134.
8859. gbvrl135.seq - Viral sequence entries, part 135.
8860. gbvrl136.seq - Viral sequence entries, part 136.
8861. gbvrl137.seq - Viral sequence entries, part 137.
8862. gbvrl138.seq - Viral sequence entries, part 138.
8863. gbvrl139.seq - Viral sequence entries, part 139.
8864. gbvrl14.seq - Viral sequence entries, part 14.
8865. gbvrl140.seq - Viral sequence entries, part 140.
8866. gbvrl141.seq - Viral sequence entries, part 141.
8867. gbvrl142.seq - Viral sequence entries, part 142.
8868. gbvrl143.seq - Viral sequence entries, part 143.
8869. gbvrl144.seq - Viral sequence entries, part 144.
8870. gbvrl145.seq - Viral sequence entries, part 145.
8871. gbvrl146.seq - Viral sequence entries, part 146.
8872. gbvrl147.seq - Viral sequence entries, part 147.
8873. gbvrl148.seq - Viral sequence entries, part 148.
8874. gbvrl149.seq - Viral sequence entries, part 149.
8875. gbvrl15.seq - Viral sequence entries, part 15.
8876. gbvrl150.seq - Viral sequence entries, part 150.
8877. gbvrl151.seq - Viral sequence entries, part 151.
8878. gbvrl152.seq - Viral sequence entries, part 152.
8879. gbvrl153.seq - Viral sequence entries, part 153.
8880. gbvrl154.seq - Viral sequence entries, part 154.
8881. gbvrl155.seq - Viral sequence entries, part 155.
8882. gbvrl156.seq - Viral sequence entries, part 156.
8883. gbvrl157.seq - Viral sequence entries, part 157.
8884. gbvrl158.seq - Viral sequence entries, part 158.
8885. gbvrl159.seq - Viral sequence entries, part 159.
8886. gbvrl16.seq - Viral sequence entries, part 16.
8887. gbvrl160.seq - Viral sequence entries, part 160.
8888. gbvrl161.seq - Viral sequence entries, part 161.
8889. gbvrl162.seq - Viral sequence entries, part 162.
8890. gbvrl163.seq - Viral sequence entries, part 163.
8891. gbvrl164.seq - Viral sequence entries, part 164.
8892. gbvrl165.seq - Viral sequence entries, part 165.
8893. gbvrl166.seq - Viral sequence entries, part 166.
8894. gbvrl167.seq - Viral sequence entries, part 167.
8895. gbvrl168.seq - Viral sequence entries, part 168.
8896. gbvrl169.seq - Viral sequence entries, part 169.
8897. gbvrl17.seq - Viral sequence entries, part 17.
8898. gbvrl170.seq - Viral sequence entries, part 170.
8899. gbvrl171.seq - Viral sequence entries, part 171.
8900. gbvrl172.seq - Viral sequence entries, part 172.
8901. gbvrl173.seq - Viral sequence entries, part 173.
8902. gbvrl174.seq - Viral sequence entries, part 174.
8903. gbvrl175.seq - Viral sequence entries, part 175.
8904. gbvrl176.seq - Viral sequence entries, part 176.
8905. gbvrl177.seq - Viral sequence entries, part 177.
8906. gbvrl178.seq - Viral sequence entries, part 178.
8907. gbvrl179.seq - Viral sequence entries, part 179.
8908. gbvrl18.seq - Viral sequence entries, part 18.
8909. gbvrl180.seq - Viral sequence entries, part 180.
8910. gbvrl181.seq - Viral sequence entries, part 181.
8911. gbvrl182.seq - Viral sequence entries, part 182.
8912. gbvrl183.seq - Viral sequence entries, part 183.
8913. gbvrl184.seq - Viral sequence entries, part 184.
8914. gbvrl185.seq - Viral sequence entries, part 185.
8915. gbvrl186.seq - Viral sequence entries, part 186.
8916. gbvrl187.seq - Viral sequence entries, part 187.
8917. gbvrl188.seq - Viral sequence entries, part 188.
8918. gbvrl189.seq - Viral sequence entries, part 189.
8919. gbvrl19.seq - Viral sequence entries, part 19.
8920. gbvrl190.seq - Viral sequence entries, part 190.
8921. gbvrl191.seq - Viral sequence entries, part 191.
8922. gbvrl192.seq - Viral sequence entries, part 192.
8923. gbvrl193.seq - Viral sequence entries, part 193.
8924. gbvrl194.seq - Viral sequence entries, part 194.
8925. gbvrl195.seq - Viral sequence entries, part 195.
8926. gbvrl196.seq - Viral sequence entries, part 196.
8927. gbvrl197.seq - Viral sequence entries, part 197.
8928. gbvrl198.seq - Viral sequence entries, part 198.
8929. gbvrl199.seq - Viral sequence entries, part 199.
8930. gbvrl2.seq - Viral sequence entries, part 2.
8931. gbvrl20.seq - Viral sequence entries, part 20.
8932. gbvrl200.seq - Viral sequence entries, part 200.
8933. gbvrl201.seq - Viral sequence entries, part 201.
8934. gbvrl202.seq - Viral sequence entries, part 202.
8935. gbvrl203.seq - Viral sequence entries, part 203.
8936. gbvrl204.seq - Viral sequence entries, part 204.
8937. gbvrl205.seq - Viral sequence entries, part 205.
8938. gbvrl206.seq - Viral sequence entries, part 206.
8939. gbvrl207.seq - Viral sequence entries, part 207.
8940. gbvrl208.seq - Viral sequence entries, part 208.
8941. gbvrl209.seq - Viral sequence entries, part 209.
8942. gbvrl21.seq - Viral sequence entries, part 21.
8943. gbvrl210.seq - Viral sequence entries, part 210.
8944. gbvrl211.seq - Viral sequence entries, part 211.
8945. gbvrl212.seq - Viral sequence entries, part 212.
8946. gbvrl213.seq - Viral sequence entries, part 213.
8947. gbvrl214.seq - Viral sequence entries, part 214.
8948. gbvrl215.seq - Viral sequence entries, part 215.
8949. gbvrl216.seq - Viral sequence entries, part 216.
8950. gbvrl217.seq - Viral sequence entries, part 217.
8951. gbvrl218.seq - Viral sequence entries, part 218.
8952. gbvrl219.seq - Viral sequence entries, part 219.
8953. gbvrl22.seq - Viral sequence entries, part 22.
8954. gbvrl220.seq - Viral sequence entries, part 220.
8955. gbvrl221.seq - Viral sequence entries, part 221.
8956. gbvrl222.seq - Viral sequence entries, part 222.
8957. gbvrl223.seq - Viral sequence entries, part 223.
8958. gbvrl224.seq - Viral sequence entries, part 224.
8959. gbvrl225.seq - Viral sequence entries, part 225.
8960. gbvrl226.seq - Viral sequence entries, part 226.
8961. gbvrl227.seq - Viral sequence entries, part 227.
8962. gbvrl228.seq - Viral sequence entries, part 228.
8963. gbvrl229.seq - Viral sequence entries, part 229.
8964. gbvrl23.seq - Viral sequence entries, part 23.
8965. gbvrl230.seq - Viral sequence entries, part 230.
8966. gbvrl231.seq - Viral sequence entries, part 231.
8967. gbvrl232.seq - Viral sequence entries, part 232.
8968. gbvrl233.seq - Viral sequence entries, part 233.
8969. gbvrl234.seq - Viral sequence entries, part 234.
8970. gbvrl235.seq - Viral sequence entries, part 235.
8971. gbvrl236.seq - Viral sequence entries, part 236.
8972. gbvrl237.seq - Viral sequence entries, part 237.
8973. gbvrl238.seq - Viral sequence entries, part 238.
8974. gbvrl239.seq - Viral sequence entries, part 239.
8975. gbvrl24.seq - Viral sequence entries, part 24.
8976. gbvrl240.seq - Viral sequence entries, part 240.
8977. gbvrl241.seq - Viral sequence entries, part 241.
8978. gbvrl242.seq - Viral sequence entries, part 242.
8979. gbvrl243.seq - Viral sequence entries, part 243.
8980. gbvrl244.seq - Viral sequence entries, part 244.
8981. gbvrl245.seq - Viral sequence entries, part 245.
8982. gbvrl246.seq - Viral sequence entries, part 246.
8983. gbvrl247.seq - Viral sequence entries, part 247.
8984. gbvrl248.seq - Viral sequence entries, part 248.
8985. gbvrl249.seq - Viral sequence entries, part 249.
8986. gbvrl25.seq - Viral sequence entries, part 25.
8987. gbvrl250.seq - Viral sequence entries, part 250.
8988. gbvrl251.seq - Viral sequence entries, part 251.
8989. gbvrl252.seq - Viral sequence entries, part 252.
8990. gbvrl253.seq - Viral sequence entries, part 253.
8991. gbvrl254.seq - Viral sequence entries, part 254.
8992. gbvrl255.seq - Viral sequence entries, part 255.
8993. gbvrl256.seq - Viral sequence entries, part 256.
8994. gbvrl257.seq - Viral sequence entries, part 257.
8995. gbvrl258.seq - Viral sequence entries, part 258.
8996. gbvrl259.seq - Viral sequence entries, part 259.
8997. gbvrl26.seq - Viral sequence entries, part 26.
8998. gbvrl260.seq - Viral sequence entries, part 260.
8999. gbvrl261.seq - Viral sequence entries, part 261.
9000. gbvrl262.seq - Viral sequence entries, part 262.
9001. gbvrl263.seq - Viral sequence entries, part 263.
9002. gbvrl264.seq - Viral sequence entries, part 264.
9003. gbvrl265.seq - Viral sequence entries, part 265.
9004. gbvrl266.seq - Viral sequence entries, part 266.
9005. gbvrl267.seq - Viral sequence entries, part 267.
9006. gbvrl268.seq - Viral sequence entries, part 268.
9007. gbvrl269.seq - Viral sequence entries, part 269.
9008. gbvrl27.seq - Viral sequence entries, part 27.
9009. gbvrl270.seq - Viral sequence entries, part 270.
9010. gbvrl271.seq - Viral sequence entries, part 271.
9011. gbvrl272.seq - Viral sequence entries, part 272.
9012. gbvrl273.seq - Viral sequence entries, part 273.
9013. gbvrl274.seq - Viral sequence entries, part 274.
9014. gbvrl275.seq - Viral sequence entries, part 275.
9015. gbvrl276.seq - Viral sequence entries, part 276.
9016. gbvrl277.seq - Viral sequence entries, part 277.
9017. gbvrl278.seq - Viral sequence entries, part 278.
9018. gbvrl279.seq - Viral sequence entries, part 279.
9019. gbvrl28.seq - Viral sequence entries, part 28.
9020. gbvrl280.seq - Viral sequence entries, part 280.
9021. gbvrl281.seq - Viral sequence entries, part 281.
9022. gbvrl282.seq - Viral sequence entries, part 282.
9023. gbvrl283.seq - Viral sequence entries, part 283.
9024. gbvrl284.seq - Viral sequence entries, part 284.
9025. gbvrl285.seq - Viral sequence entries, part 285.
9026. gbvrl286.seq - Viral sequence entries, part 286.
9027. gbvrl287.seq - Viral sequence entries, part 287.
9028. gbvrl288.seq - Viral sequence entries, part 288.
9029. gbvrl289.seq - Viral sequence entries, part 289.
9030. gbvrl29.seq - Viral sequence entries, part 29.
9031. gbvrl290.seq - Viral sequence entries, part 290.
9032. gbvrl291.seq - Viral sequence entries, part 291.
9033. gbvrl292.seq - Viral sequence entries, part 292.
9034. gbvrl293.seq - Viral sequence entries, part 293.
9035. gbvrl294.seq - Viral sequence entries, part 294.
9036. gbvrl295.seq - Viral sequence entries, part 295.
9037. gbvrl296.seq - Viral sequence entries, part 296.
9038. gbvrl297.seq - Viral sequence entries, part 297.
9039. gbvrl298.seq - Viral sequence entries, part 298.
9040. gbvrl299.seq - Viral sequence entries, part 299.
9041. gbvrl3.seq - Viral sequence entries, part 3.
9042. gbvrl30.seq - Viral sequence entries, part 30.
9043. gbvrl300.seq - Viral sequence entries, part 300.
9044. gbvrl301.seq - Viral sequence entries, part 301.
9045. gbvrl302.seq - Viral sequence entries, part 302.
9046. gbvrl303.seq - Viral sequence entries, part 303.
9047. gbvrl304.seq - Viral sequence entries, part 304.
9048. gbvrl305.seq - Viral sequence entries, part 305.
9049. gbvrl306.seq - Viral sequence entries, part 306.
9050. gbvrl307.seq - Viral sequence entries, part 307.
9051. gbvrl308.seq - Viral sequence entries, part 308.
9052. gbvrl309.seq - Viral sequence entries, part 309.
9053. gbvrl31.seq - Viral sequence entries, part 31.
9054. gbvrl310.seq - Viral sequence entries, part 310.
9055. gbvrl311.seq - Viral sequence entries, part 311.
9056. gbvrl312.seq - Viral sequence entries, part 312.
9057. gbvrl313.seq - Viral sequence entries, part 313.
9058. gbvrl314.seq - Viral sequence entries, part 314.
9059. gbvrl315.seq - Viral sequence entries, part 315.
9060. gbvrl316.seq - Viral sequence entries, part 316.
9061. gbvrl317.seq - Viral sequence entries, part 317.
9062. gbvrl318.seq - Viral sequence entries, part 318.
9063. gbvrl319.seq - Viral sequence entries, part 319.
9064. gbvrl32.seq - Viral sequence entries, part 32.
9065. gbvrl320.seq - Viral sequence entries, part 320.
9066. gbvrl321.seq - Viral sequence entries, part 321.
9067. gbvrl322.seq - Viral sequence entries, part 322.
9068. gbvrl323.seq - Viral sequence entries, part 323.
9069. gbvrl324.seq - Viral sequence entries, part 324.
9070. gbvrl325.seq - Viral sequence entries, part 325.
9071. gbvrl326.seq - Viral sequence entries, part 326.
9072. gbvrl327.seq - Viral sequence entries, part 327.
9073. gbvrl328.seq - Viral sequence entries, part 328.
9074. gbvrl329.seq - Viral sequence entries, part 329.
9075. gbvrl33.seq - Viral sequence entries, part 33.
9076. gbvrl330.seq - Viral sequence entries, part 330.
9077. gbvrl331.seq - Viral sequence entries, part 331.
9078. gbvrl332.seq - Viral sequence entries, part 332.
9079. gbvrl333.seq - Viral sequence entries, part 333.
9080. gbvrl334.seq - Viral sequence entries, part 334.
9081. gbvrl335.seq - Viral sequence entries, part 335.
9082. gbvrl336.seq - Viral sequence entries, part 336.
9083. gbvrl337.seq - Viral sequence entries, part 337.
9084. gbvrl338.seq - Viral sequence entries, part 338.
9085. gbvrl339.seq - Viral sequence entries, part 339.
9086. gbvrl34.seq - Viral sequence entries, part 34.
9087. gbvrl340.seq - Viral sequence entries, part 340.
9088. gbvrl341.seq - Viral sequence entries, part 341.
9089. gbvrl342.seq - Viral sequence entries, part 342.
9090. gbvrl343.seq - Viral sequence entries, part 343.
9091. gbvrl344.seq - Viral sequence entries, part 344.
9092. gbvrl345.seq - Viral sequence entries, part 345.
9093. gbvrl346.seq - Viral sequence entries, part 346.
9094. gbvrl347.seq - Viral sequence entries, part 347.
9095. gbvrl348.seq - Viral sequence entries, part 348.
9096. gbvrl349.seq - Viral sequence entries, part 349.
9097. gbvrl35.seq - Viral sequence entries, part 35.
9098. gbvrl350.seq - Viral sequence entries, part 350.
9099. gbvrl351.seq - Viral sequence entries, part 351.
9100. gbvrl352.seq - Viral sequence entries, part 352.
9101. gbvrl353.seq - Viral sequence entries, part 353.
9102. gbvrl354.seq - Viral sequence entries, part 354.
9103. gbvrl355.seq - Viral sequence entries, part 355.
9104. gbvrl356.seq - Viral sequence entries, part 356.
9105. gbvrl357.seq - Viral sequence entries, part 357.
9106. gbvrl358.seq - Viral sequence entries, part 358.
9107. gbvrl359.seq - Viral sequence entries, part 359.
9108. gbvrl36.seq - Viral sequence entries, part 36.
9109. gbvrl360.seq - Viral sequence entries, part 360.
9110. gbvrl361.seq - Viral sequence entries, part 361.
9111. gbvrl362.seq - Viral sequence entries, part 362.
9112. gbvrl363.seq - Viral sequence entries, part 363.
9113. gbvrl364.seq - Viral sequence entries, part 364.
9114. gbvrl365.seq - Viral sequence entries, part 365.
9115. gbvrl366.seq - Viral sequence entries, part 366.
9116. gbvrl367.seq - Viral sequence entries, part 367.
9117. gbvrl368.seq - Viral sequence entries, part 368.
9118. gbvrl369.seq - Viral sequence entries, part 369.
9119. gbvrl37.seq - Viral sequence entries, part 37.
9120. gbvrl370.seq - Viral sequence entries, part 370.
9121. gbvrl371.seq - Viral sequence entries, part 371.
9122. gbvrl372.seq - Viral sequence entries, part 372.
9123. gbvrl373.seq - Viral sequence entries, part 373.
9124. gbvrl374.seq - Viral sequence entries, part 374.
9125. gbvrl375.seq - Viral sequence entries, part 375.
9126. gbvrl376.seq - Viral sequence entries, part 376.
9127. gbvrl377.seq - Viral sequence entries, part 377.
9128. gbvrl378.seq - Viral sequence entries, part 378.
9129. gbvrl379.seq - Viral sequence entries, part 379.
9130. gbvrl38.seq - Viral sequence entries, part 38.
9131. gbvrl380.seq - Viral sequence entries, part 380.
9132. gbvrl381.seq - Viral sequence entries, part 381.
9133. gbvrl382.seq - Viral sequence entries, part 382.
9134. gbvrl383.seq - Viral sequence entries, part 383.
9135. gbvrl384.seq - Viral sequence entries, part 384.
9136. gbvrl385.seq - Viral sequence entries, part 385.
9137. gbvrl386.seq - Viral sequence entries, part 386.
9138. gbvrl387.seq - Viral sequence entries, part 387.
9139. gbvrl388.seq - Viral sequence entries, part 388.
9140. gbvrl389.seq - Viral sequence entries, part 389.
9141. gbvrl39.seq - Viral sequence entries, part 39.
9142. gbvrl390.seq - Viral sequence entries, part 390.
9143. gbvrl391.seq - Viral sequence entries, part 391.
9144. gbvrl392.seq - Viral sequence entries, part 392.
9145. gbvrl393.seq - Viral sequence entries, part 393.
9146. gbvrl394.seq - Viral sequence entries, part 394.
9147. gbvrl395.seq - Viral sequence entries, part 395.
9148. gbvrl396.seq - Viral sequence entries, part 396.
9149. gbvrl397.seq - Viral sequence entries, part 397.
9150. gbvrl398.seq - Viral sequence entries, part 398.
9151. gbvrl399.seq - Viral sequence entries, part 399.
9152. gbvrl4.seq - Viral sequence entries, part 4.
9153. gbvrl40.seq - Viral sequence entries, part 40.
9154. gbvrl400.seq - Viral sequence entries, part 400.
9155. gbvrl401.seq - Viral sequence entries, part 401.
9156. gbvrl402.seq - Viral sequence entries, part 402.
9157. gbvrl403.seq - Viral sequence entries, part 403.
9158. gbvrl404.seq - Viral sequence entries, part 404.
9159. gbvrl405.seq - Viral sequence entries, part 405.
9160. gbvrl406.seq - Viral sequence entries, part 406.
9161. gbvrl407.seq - Viral sequence entries, part 407.
9162. gbvrl408.seq - Viral sequence entries, part 408.
9163. gbvrl409.seq - Viral sequence entries, part 409.
9164. gbvrl41.seq - Viral sequence entries, part 41.
9165. gbvrl410.seq - Viral sequence entries, part 410.
9166. gbvrl411.seq - Viral sequence entries, part 411.
9167. gbvrl412.seq - Viral sequence entries, part 412.
9168. gbvrl413.seq - Viral sequence entries, part 413.
9169. gbvrl414.seq - Viral sequence entries, part 414.
9170. gbvrl415.seq - Viral sequence entries, part 415.
9171. gbvrl416.seq - Viral sequence entries, part 416.
9172. gbvrl417.seq - Viral sequence entries, part 417.
9173. gbvrl418.seq - Viral sequence entries, part 418.
9174. gbvrl419.seq - Viral sequence entries, part 419.
9175. gbvrl42.seq - Viral sequence entries, part 42.
9176. gbvrl420.seq - Viral sequence entries, part 420.
9177. gbvrl421.seq - Viral sequence entries, part 421.
9178. gbvrl422.seq - Viral sequence entries, part 422.
9179. gbvrl423.seq - Viral sequence entries, part 423.
9180. gbvrl424.seq - Viral sequence entries, part 424.
9181. gbvrl425.seq - Viral sequence entries, part 425.
9182. gbvrl426.seq - Viral sequence entries, part 426.
9183. gbvrl427.seq - Viral sequence entries, part 427.
9184. gbvrl428.seq - Viral sequence entries, part 428.
9185. gbvrl429.seq - Viral sequence entries, part 429.
9186. gbvrl43.seq - Viral sequence entries, part 43.
9187. gbvrl430.seq - Viral sequence entries, part 430.
9188. gbvrl431.seq - Viral sequence entries, part 431.
9189. gbvrl432.seq - Viral sequence entries, part 432.
9190. gbvrl433.seq - Viral sequence entries, part 433.
9191. gbvrl434.seq - Viral sequence entries, part 434.
9192. gbvrl435.seq - Viral sequence entries, part 435.
9193. gbvrl436.seq - Viral sequence entries, part 436.
9194. gbvrl437.seq - Viral sequence entries, part 437.
9195. gbvrl438.seq - Viral sequence entries, part 438.
9196. gbvrl439.seq - Viral sequence entries, part 439.
9197. gbvrl44.seq - Viral sequence entries, part 44.
9198. gbvrl440.seq - Viral sequence entries, part 440.
9199. gbvrl441.seq - Viral sequence entries, part 441.
9200. gbvrl442.seq - Viral sequence entries, part 442.
9201. gbvrl443.seq - Viral sequence entries, part 443.
9202. gbvrl444.seq - Viral sequence entries, part 444.
9203. gbvrl445.seq - Viral sequence entries, part 445.
9204. gbvrl446.seq - Viral sequence entries, part 446.
9205. gbvrl447.seq - Viral sequence entries, part 447.
9206. gbvrl448.seq - Viral sequence entries, part 448.
9207. gbvrl449.seq - Viral sequence entries, part 449.
9208. gbvrl45.seq - Viral sequence entries, part 45.
9209. gbvrl450.seq - Viral sequence entries, part 450.
9210. gbvrl451.seq - Viral sequence entries, part 451.
9211. gbvrl452.seq - Viral sequence entries, part 452.
9212. gbvrl453.seq - Viral sequence entries, part 453.
9213. gbvrl454.seq - Viral sequence entries, part 454.
9214. gbvrl455.seq - Viral sequence entries, part 455.
9215. gbvrl456.seq - Viral sequence entries, part 456.
9216. gbvrl457.seq - Viral sequence entries, part 457.
9217. gbvrl458.seq - Viral sequence entries, part 458.
9218. gbvrl459.seq - Viral sequence entries, part 459.
9219. gbvrl46.seq - Viral sequence entries, part 46.
9220. gbvrl460.seq - Viral sequence entries, part 460.
9221. gbvrl461.seq - Viral sequence entries, part 461.
9222. gbvrl462.seq - Viral sequence entries, part 462.
9223. gbvrl463.seq - Viral sequence entries, part 463.
9224. gbvrl464.seq - Viral sequence entries, part 464.
9225. gbvrl465.seq - Viral sequence entries, part 465.
9226. gbvrl466.seq - Viral sequence entries, part 466.
9227. gbvrl467.seq - Viral sequence entries, part 467.
9228. gbvrl468.seq - Viral sequence entries, part 468.
9229. gbvrl469.seq - Viral sequence entries, part 469.
9230. gbvrl47.seq - Viral sequence entries, part 47.
9231. gbvrl470.seq - Viral sequence entries, part 470.
9232. gbvrl471.seq - Viral sequence entries, part 471.
9233. gbvrl472.seq - Viral sequence entries, part 472.
9234. gbvrl473.seq - Viral sequence entries, part 473.
9235. gbvrl474.seq - Viral sequence entries, part 474.
9236. gbvrl475.seq - Viral sequence entries, part 475.
9237. gbvrl476.seq - Viral sequence entries, part 476.
9238. gbvrl477.seq - Viral sequence entries, part 477.
9239. gbvrl478.seq - Viral sequence entries, part 478.
9240. gbvrl479.seq - Viral sequence entries, part 479.
9241. gbvrl48.seq - Viral sequence entries, part 48.
9242. gbvrl480.seq - Viral sequence entries, part 480.
9243. gbvrl481.seq - Viral sequence entries, part 481.
9244. gbvrl482.seq - Viral sequence entries, part 482.
9245. gbvrl483.seq - Viral sequence entries, part 483.
9246. gbvrl484.seq - Viral sequence entries, part 484.
9247. gbvrl485.seq - Viral sequence entries, part 485.
9248. gbvrl486.seq - Viral sequence entries, part 486.
9249. gbvrl487.seq - Viral sequence entries, part 487.
9250. gbvrl488.seq - Viral sequence entries, part 488.
9251. gbvrl489.seq - Viral sequence entries, part 489.
9252. gbvrl49.seq - Viral sequence entries, part 49.
9253. gbvrl490.seq - Viral sequence entries, part 490.
9254. gbvrl491.seq - Viral sequence entries, part 491.
9255. gbvrl492.seq - Viral sequence entries, part 492.
9256. gbvrl493.seq - Viral sequence entries, part 493.
9257. gbvrl494.seq - Viral sequence entries, part 494.
9258. gbvrl495.seq - Viral sequence entries, part 495.
9259. gbvrl496.seq - Viral sequence entries, part 496.
9260. gbvrl497.seq - Viral sequence entries, part 497.
9261. gbvrl498.seq - Viral sequence entries, part 498.
9262. gbvrl499.seq - Viral sequence entries, part 499.
9263. gbvrl5.seq - Viral sequence entries, part 5.
9264. gbvrl50.seq - Viral sequence entries, part 50.
9265. gbvrl500.seq - Viral sequence entries, part 500.
9266. gbvrl501.seq - Viral sequence entries, part 501.
9267. gbvrl502.seq - Viral sequence entries, part 502.
9268. gbvrl503.seq - Viral sequence entries, part 503.
9269. gbvrl504.seq - Viral sequence entries, part 504.
9270. gbvrl505.seq - Viral sequence entries, part 505.
9271. gbvrl506.seq - Viral sequence entries, part 506.
9272. gbvrl507.seq - Viral sequence entries, part 507.
9273. gbvrl508.seq - Viral sequence entries, part 508.
9274. gbvrl509.seq - Viral sequence entries, part 509.
9275. gbvrl51.seq - Viral sequence entries, part 51.
9276. gbvrl510.seq - Viral sequence entries, part 510.
9277. gbvrl511.seq - Viral sequence entries, part 511.
9278. gbvrl512.seq - Viral sequence entries, part 512.
9279. gbvrl513.seq - Viral sequence entries, part 513.
9280. gbvrl514.seq - Viral sequence entries, part 514.
9281. gbvrl515.seq - Viral sequence entries, part 515.
9282. gbvrl516.seq - Viral sequence entries, part 516.
9283. gbvrl517.seq - Viral sequence entries, part 517.
9284. gbvrl518.seq - Viral sequence entries, part 518.
9285. gbvrl519.seq - Viral sequence entries, part 519.
9286. gbvrl52.seq - Viral sequence entries, part 52.
9287. gbvrl520.seq - Viral sequence entries, part 520.
9288. gbvrl521.seq - Viral sequence entries, part 521.
9289. gbvrl522.seq - Viral sequence entries, part 522.
9290. gbvrl523.seq - Viral sequence entries, part 523.
9291. gbvrl524.seq - Viral sequence entries, part 524.
9292. gbvrl525.seq - Viral sequence entries, part 525.
9293. gbvrl526.seq - Viral sequence entries, part 526.
9294. gbvrl527.seq - Viral sequence entries, part 527.
9295. gbvrl528.seq - Viral sequence entries, part 528.
9296. gbvrl529.seq - Viral sequence entries, part 529.
9297. gbvrl53.seq - Viral sequence entries, part 53.
9298. gbvrl530.seq - Viral sequence entries, part 530.
9299. gbvrl531.seq - Viral sequence entries, part 531.
9300. gbvrl532.seq - Viral sequence entries, part 532.
9301. gbvrl533.seq - Viral sequence entries, part 533.
9302. gbvrl534.seq - Viral sequence entries, part 534.
9303. gbvrl535.seq - Viral sequence entries, part 535.
9304. gbvrl536.seq - Viral sequence entries, part 536.
9305. gbvrl537.seq - Viral sequence entries, part 537.
9306. gbvrl538.seq - Viral sequence entries, part 538.
9307. gbvrl539.seq - Viral sequence entries, part 539.
9308. gbvrl54.seq - Viral sequence entries, part 54.
9309. gbvrl540.seq - Viral sequence entries, part 540.
9310. gbvrl541.seq - Viral sequence entries, part 541.
9311. gbvrl542.seq - Viral sequence entries, part 542.
9312. gbvrl543.seq - Viral sequence entries, part 543.
9313. gbvrl544.seq - Viral sequence entries, part 544.
9314. gbvrl545.seq - Viral sequence entries, part 545.
9315. gbvrl546.seq - Viral sequence entries, part 546.
9316. gbvrl547.seq - Viral sequence entries, part 547.
9317. gbvrl548.seq - Viral sequence entries, part 548.
9318. gbvrl549.seq - Viral sequence entries, part 549.
9319. gbvrl55.seq - Viral sequence entries, part 55.
9320. gbvrl550.seq - Viral sequence entries, part 550.
9321. gbvrl551.seq - Viral sequence entries, part 551.
9322. gbvrl552.seq - Viral sequence entries, part 552.
9323. gbvrl553.seq - Viral sequence entries, part 553.
9324. gbvrl554.seq - Viral sequence entries, part 554.
9325. gbvrl555.seq - Viral sequence entries, part 555.
9326. gbvrl556.seq - Viral sequence entries, part 556.
9327. gbvrl557.seq - Viral sequence entries, part 557.
9328. gbvrl558.seq - Viral sequence entries, part 558.
9329. gbvrl559.seq - Viral sequence entries, part 559.
9330. gbvrl56.seq - Viral sequence entries, part 56.
9331. gbvrl560.seq - Viral sequence entries, part 560.
9332. gbvrl561.seq - Viral sequence entries, part 561.
9333. gbvrl562.seq - Viral sequence entries, part 562.
9334. gbvrl563.seq - Viral sequence entries, part 563.
9335. gbvrl564.seq - Viral sequence entries, part 564.
9336. gbvrl565.seq - Viral sequence entries, part 565.
9337. gbvrl566.seq - Viral sequence entries, part 566.
9338. gbvrl567.seq - Viral sequence entries, part 567.
9339. gbvrl568.seq - Viral sequence entries, part 568.
9340. gbvrl569.seq - Viral sequence entries, part 569.
9341. gbvrl57.seq - Viral sequence entries, part 57.
9342. gbvrl570.seq - Viral sequence entries, part 570.
9343. gbvrl571.seq - Viral sequence entries, part 571.
9344. gbvrl572.seq - Viral sequence entries, part 572.
9345. gbvrl573.seq - Viral sequence entries, part 573.
9346. gbvrl574.seq - Viral sequence entries, part 574.
9347. gbvrl575.seq - Viral sequence entries, part 575.
9348. gbvrl576.seq - Viral sequence entries, part 576.
9349. gbvrl577.seq - Viral sequence entries, part 577.
9350. gbvrl578.seq - Viral sequence entries, part 578.
9351. gbvrl579.seq - Viral sequence entries, part 579.
9352. gbvrl58.seq - Viral sequence entries, part 58.
9353. gbvrl580.seq - Viral sequence entries, part 580.
9354. gbvrl581.seq - Viral sequence entries, part 581.
9355. gbvrl582.seq - Viral sequence entries, part 582.
9356. gbvrl583.seq - Viral sequence entries, part 583.
9357. gbvrl584.seq - Viral sequence entries, part 584.
9358. gbvrl585.seq - Viral sequence entries, part 585.
9359. gbvrl586.seq - Viral sequence entries, part 586.
9360. gbvrl587.seq - Viral sequence entries, part 587.
9361. gbvrl588.seq - Viral sequence entries, part 588.
9362. gbvrl589.seq - Viral sequence entries, part 589.
9363. gbvrl59.seq - Viral sequence entries, part 59.
9364. gbvrl590.seq - Viral sequence entries, part 590.
9365. gbvrl591.seq - Viral sequence entries, part 591.
9366. gbvrl592.seq - Viral sequence entries, part 592.
9367. gbvrl593.seq - Viral sequence entries, part 593.
9368. gbvrl594.seq - Viral sequence entries, part 594.
9369. gbvrl595.seq - Viral sequence entries, part 595.
9370. gbvrl596.seq - Viral sequence entries, part 596.
9371. gbvrl597.seq - Viral sequence entries, part 597.
9372. gbvrl598.seq - Viral sequence entries, part 598.
9373. gbvrl599.seq - Viral sequence entries, part 599.
9374. gbvrl6.seq - Viral sequence entries, part 6.
9375. gbvrl60.seq - Viral sequence entries, part 60.
9376. gbvrl600.seq - Viral sequence entries, part 600.
9377. gbvrl601.seq - Viral sequence entries, part 601.
9378. gbvrl602.seq - Viral sequence entries, part 602.
9379. gbvrl603.seq - Viral sequence entries, part 603.
9380. gbvrl604.seq - Viral sequence entries, part 604.
9381. gbvrl605.seq - Viral sequence entries, part 605.
9382. gbvrl606.seq - Viral sequence entries, part 606.
9383. gbvrl607.seq - Viral sequence entries, part 607.
9384. gbvrl608.seq - Viral sequence entries, part 608.
9385. gbvrl609.seq - Viral sequence entries, part 609.
9386. gbvrl61.seq - Viral sequence entries, part 61.
9387. gbvrl610.seq - Viral sequence entries, part 610.
9388. gbvrl611.seq - Viral sequence entries, part 611.
9389. gbvrl612.seq - Viral sequence entries, part 612.
9390. gbvrl613.seq - Viral sequence entries, part 613.
9391. gbvrl614.seq - Viral sequence entries, part 614.
9392. gbvrl615.seq - Viral sequence entries, part 615.
9393. gbvrl616.seq - Viral sequence entries, part 616.
9394. gbvrl617.seq - Viral sequence entries, part 617.
9395. gbvrl618.seq - Viral sequence entries, part 618.
9396. gbvrl619.seq - Viral sequence entries, part 619.
9397. gbvrl62.seq - Viral sequence entries, part 62.
9398. gbvrl620.seq - Viral sequence entries, part 620.
9399. gbvrl621.seq - Viral sequence entries, part 621.
9400. gbvrl622.seq - Viral sequence entries, part 622.
9401. gbvrl623.seq - Viral sequence entries, part 623.
9402. gbvrl624.seq - Viral sequence entries, part 624.
9403. gbvrl625.seq - Viral sequence entries, part 625.
9404. gbvrl626.seq - Viral sequence entries, part 626.
9405. gbvrl627.seq - Viral sequence entries, part 627.
9406. gbvrl628.seq - Viral sequence entries, part 628.
9407. gbvrl629.seq - Viral sequence entries, part 629.
9408. gbvrl63.seq - Viral sequence entries, part 63.
9409. gbvrl630.seq - Viral sequence entries, part 630.
9410. gbvrl631.seq - Viral sequence entries, part 631.
9411. gbvrl632.seq - Viral sequence entries, part 632.
9412. gbvrl633.seq - Viral sequence entries, part 633.
9413. gbvrl634.seq - Viral sequence entries, part 634.
9414. gbvrl635.seq - Viral sequence entries, part 635.
9415. gbvrl636.seq - Viral sequence entries, part 636.
9416. gbvrl637.seq - Viral sequence entries, part 637.
9417. gbvrl638.seq - Viral sequence entries, part 638.
9418. gbvrl639.seq - Viral sequence entries, part 639.
9419. gbvrl64.seq - Viral sequence entries, part 64.
9420. gbvrl640.seq - Viral sequence entries, part 640.
9421. gbvrl641.seq - Viral sequence entries, part 641.
9422. gbvrl642.seq - Viral sequence entries, part 642.
9423. gbvrl643.seq - Viral sequence entries, part 643.
9424. gbvrl644.seq - Viral sequence entries, part 644.
9425. gbvrl645.seq - Viral sequence entries, part 645.
9426. gbvrl646.seq - Viral sequence entries, part 646.
9427. gbvrl647.seq - Viral sequence entries, part 647.
9428. gbvrl648.seq - Viral sequence entries, part 648.
9429. gbvrl649.seq - Viral sequence entries, part 649.
9430. gbvrl65.seq - Viral sequence entries, part 65.
9431. gbvrl650.seq - Viral sequence entries, part 650.
9432. gbvrl651.seq - Viral sequence entries, part 651.
9433. gbvrl652.seq - Viral sequence entries, part 652.
9434. gbvrl653.seq - Viral sequence entries, part 653.
9435. gbvrl654.seq - Viral sequence entries, part 654.
9436. gbvrl655.seq - Viral sequence entries, part 655.
9437. gbvrl656.seq - Viral sequence entries, part 656.
9438. gbvrl657.seq - Viral sequence entries, part 657.
9439. gbvrl658.seq - Viral sequence entries, part 658.
9440. gbvrl659.seq - Viral sequence entries, part 659.
9441. gbvrl66.seq - Viral sequence entries, part 66.
9442. gbvrl660.seq - Viral sequence entries, part 660.
9443. gbvrl661.seq - Viral sequence entries, part 661.
9444. gbvrl662.seq - Viral sequence entries, part 662.
9445. gbvrl663.seq - Viral sequence entries, part 663.
9446. gbvrl664.seq - Viral sequence entries, part 664.
9447. gbvrl665.seq - Viral sequence entries, part 665.
9448. gbvrl666.seq - Viral sequence entries, part 666.
9449. gbvrl667.seq - Viral sequence entries, part 667.
9450. gbvrl668.seq - Viral sequence entries, part 668.
9451. gbvrl669.seq - Viral sequence entries, part 669.
9452. gbvrl67.seq - Viral sequence entries, part 67.
9453. gbvrl670.seq - Viral sequence entries, part 670.
9454. gbvrl671.seq - Viral sequence entries, part 671.
9455. gbvrl672.seq - Viral sequence entries, part 672.
9456. gbvrl673.seq - Viral sequence entries, part 673.
9457. gbvrl674.seq - Viral sequence entries, part 674.
9458. gbvrl675.seq - Viral sequence entries, part 675.
9459. gbvrl676.seq - Viral sequence entries, part 676.
9460. gbvrl677.seq - Viral sequence entries, part 677.
9461. gbvrl678.seq - Viral sequence entries, part 678.
9462. gbvrl679.seq - Viral sequence entries, part 679.
9463. gbvrl68.seq - Viral sequence entries, part 68.
9464. gbvrl680.seq - Viral sequence entries, part 680.
9465. gbvrl681.seq - Viral sequence entries, part 681.
9466. gbvrl682.seq - Viral sequence entries, part 682.
9467. gbvrl683.seq - Viral sequence entries, part 683.
9468. gbvrl684.seq - Viral sequence entries, part 684.
9469. gbvrl685.seq - Viral sequence entries, part 685.
9470. gbvrl686.seq - Viral sequence entries, part 686.
9471. gbvrl687.seq - Viral sequence entries, part 687.
9472. gbvrl688.seq - Viral sequence entries, part 688.
9473. gbvrl689.seq - Viral sequence entries, part 689.
9474. gbvrl69.seq - Viral sequence entries, part 69.
9475. gbvrl690.seq - Viral sequence entries, part 690.
9476. gbvrl691.seq - Viral sequence entries, part 691.
9477. gbvrl692.seq - Viral sequence entries, part 692.
9478. gbvrl693.seq - Viral sequence entries, part 693.
9479. gbvrl694.seq - Viral sequence entries, part 694.
9480. gbvrl695.seq - Viral sequence entries, part 695.
9481. gbvrl696.seq - Viral sequence entries, part 696.
9482. gbvrl697.seq - Viral sequence entries, part 697.
9483. gbvrl698.seq - Viral sequence entries, part 698.
9484. gbvrl699.seq - Viral sequence entries, part 699.
9485. gbvrl7.seq - Viral sequence entries, part 7.
9486. gbvrl70.seq - Viral sequence entries, part 70.
9487. gbvrl700.seq - Viral sequence entries, part 700.
9488. gbvrl701.seq - Viral sequence entries, part 701.
9489. gbvrl702.seq - Viral sequence entries, part 702.
9490. gbvrl703.seq - Viral sequence entries, part 703.
9491. gbvrl704.seq - Viral sequence entries, part 704.
9492. gbvrl705.seq - Viral sequence entries, part 705.
9493. gbvrl706.seq - Viral sequence entries, part 706.
9494. gbvrl707.seq - Viral sequence entries, part 707.
9495. gbvrl708.seq - Viral sequence entries, part 708.
9496. gbvrl709.seq - Viral sequence entries, part 709.
9497. gbvrl71.seq - Viral sequence entries, part 71.
9498. gbvrl710.seq - Viral sequence entries, part 710.
9499. gbvrl711.seq - Viral sequence entries, part 711.
9500. gbvrl712.seq - Viral sequence entries, part 712.
9501. gbvrl713.seq - Viral sequence entries, part 713.
9502. gbvrl714.seq - Viral sequence entries, part 714.
9503. gbvrl715.seq - Viral sequence entries, part 715.
9504. gbvrl716.seq - Viral sequence entries, part 716.
9505. gbvrl717.seq - Viral sequence entries, part 717.
9506. gbvrl718.seq - Viral sequence entries, part 718.
9507. gbvrl719.seq - Viral sequence entries, part 719.
9508. gbvrl72.seq - Viral sequence entries, part 72.
9509. gbvrl720.seq - Viral sequence entries, part 720.
9510. gbvrl721.seq - Viral sequence entries, part 721.
9511. gbvrl722.seq - Viral sequence entries, part 722.
9512. gbvrl723.seq - Viral sequence entries, part 723.
9513. gbvrl724.seq - Viral sequence entries, part 724.
9514. gbvrl725.seq - Viral sequence entries, part 725.
9515. gbvrl726.seq - Viral sequence entries, part 726.
9516. gbvrl727.seq - Viral sequence entries, part 727.
9517. gbvrl728.seq - Viral sequence entries, part 728.
9518. gbvrl729.seq - Viral sequence entries, part 729.
9519. gbvrl73.seq - Viral sequence entries, part 73.
9520. gbvrl730.seq - Viral sequence entries, part 730.
9521. gbvrl731.seq - Viral sequence entries, part 731.
9522. gbvrl732.seq - Viral sequence entries, part 732.
9523. gbvrl733.seq - Viral sequence entries, part 733.
9524. gbvrl734.seq - Viral sequence entries, part 734.
9525. gbvrl735.seq - Viral sequence entries, part 735.
9526. gbvrl736.seq - Viral sequence entries, part 736.
9527. gbvrl737.seq - Viral sequence entries, part 737.
9528. gbvrl738.seq - Viral sequence entries, part 738.
9529. gbvrl739.seq - Viral sequence entries, part 739.
9530. gbvrl74.seq - Viral sequence entries, part 74.
9531. gbvrl740.seq - Viral sequence entries, part 740.
9532. gbvrl741.seq - Viral sequence entries, part 741.
9533. gbvrl742.seq - Viral sequence entries, part 742.
9534. gbvrl743.seq - Viral sequence entries, part 743.
9535. gbvrl744.seq - Viral sequence entries, part 744.
9536. gbvrl745.seq - Viral sequence entries, part 745.
9537. gbvrl746.seq - Viral sequence entries, part 746.
9538. gbvrl747.seq - Viral sequence entries, part 747.
9539. gbvrl748.seq - Viral sequence entries, part 748.
9540. gbvrl749.seq - Viral sequence entries, part 749.
9541. gbvrl75.seq - Viral sequence entries, part 75.
9542. gbvrl750.seq - Viral sequence entries, part 750.
9543. gbvrl751.seq - Viral sequence entries, part 751.
9544. gbvrl752.seq - Viral sequence entries, part 752.
9545. gbvrl753.seq - Viral sequence entries, part 753.
9546. gbvrl754.seq - Viral sequence entries, part 754.
9547. gbvrl755.seq - Viral sequence entries, part 755.
9548. gbvrl756.seq - Viral sequence entries, part 756.
9549. gbvrl757.seq - Viral sequence entries, part 757.
9550. gbvrl758.seq - Viral sequence entries, part 758.
9551. gbvrl759.seq - Viral sequence entries, part 759.
9552. gbvrl76.seq - Viral sequence entries, part 76.
9553. gbvrl760.seq - Viral sequence entries, part 760.
9554. gbvrl761.seq - Viral sequence entries, part 761.
9555. gbvrl762.seq - Viral sequence entries, part 762.
9556. gbvrl763.seq - Viral sequence entries, part 763.
9557. gbvrl764.seq - Viral sequence entries, part 764.
9558. gbvrl765.seq - Viral sequence entries, part 765.
9559. gbvrl766.seq - Viral sequence entries, part 766.
9560. gbvrl767.seq - Viral sequence entries, part 767.
9561. gbvrl768.seq - Viral sequence entries, part 768.
9562. gbvrl769.seq - Viral sequence entries, part 769.
9563. gbvrl77.seq - Viral sequence entries, part 77.
9564. gbvrl770.seq - Viral sequence entries, part 770.
9565. gbvrl771.seq - Viral sequence entries, part 771.
9566. gbvrl772.seq - Viral sequence entries, part 772.
9567. gbvrl773.seq - Viral sequence entries, part 773.
9568. gbvrl774.seq - Viral sequence entries, part 774.
9569. gbvrl775.seq - Viral sequence entries, part 775.
9570. gbvrl776.seq - Viral sequence entries, part 776.
9571. gbvrl777.seq - Viral sequence entries, part 777.
9572. gbvrl778.seq - Viral sequence entries, part 778.
9573. gbvrl779.seq - Viral sequence entries, part 779.
9574. gbvrl78.seq - Viral sequence entries, part 78.
9575. gbvrl780.seq - Viral sequence entries, part 780.
9576. gbvrl781.seq - Viral sequence entries, part 781.
9577. gbvrl782.seq - Viral sequence entries, part 782.
9578. gbvrl783.seq - Viral sequence entries, part 783.
9579. gbvrl784.seq - Viral sequence entries, part 784.
9580. gbvrl785.seq - Viral sequence entries, part 785.
9581. gbvrl786.seq - Viral sequence entries, part 786.
9582. gbvrl787.seq - Viral sequence entries, part 787.
9583. gbvrl788.seq - Viral sequence entries, part 788.
9584. gbvrl789.seq - Viral sequence entries, part 789.
9585. gbvrl79.seq - Viral sequence entries, part 79.
9586. gbvrl790.seq - Viral sequence entries, part 790.
9587. gbvrl791.seq - Viral sequence entries, part 791.
9588. gbvrl792.seq - Viral sequence entries, part 792.
9589. gbvrl793.seq - Viral sequence entries, part 793.
9590. gbvrl794.seq - Viral sequence entries, part 794.
9591. gbvrl795.seq - Viral sequence entries, part 795.
9592. gbvrl796.seq - Viral sequence entries, part 796.
9593. gbvrl797.seq - Viral sequence entries, part 797.
9594. gbvrl798.seq - Viral sequence entries, part 798.
9595. gbvrl799.seq - Viral sequence entries, part 799.
9596. gbvrl8.seq - Viral sequence entries, part 8.
9597. gbvrl80.seq - Viral sequence entries, part 80.
9598. gbvrl800.seq - Viral sequence entries, part 800.
9599. gbvrl801.seq - Viral sequence entries, part 801.
9600. gbvrl802.seq - Viral sequence entries, part 802.
9601. gbvrl803.seq - Viral sequence entries, part 803.
9602. gbvrl804.seq - Viral sequence entries, part 804.
9603. gbvrl805.seq - Viral sequence entries, part 805.
9604. gbvrl806.seq - Viral sequence entries, part 806.
9605. gbvrl807.seq - Viral sequence entries, part 807.
9606. gbvrl808.seq - Viral sequence entries, part 808.
9607. gbvrl809.seq - Viral sequence entries, part 809.
9608. gbvrl81.seq - Viral sequence entries, part 81.
9609. gbvrl810.seq - Viral sequence entries, part 810.
9610. gbvrl811.seq - Viral sequence entries, part 811.
9611. gbvrl812.seq - Viral sequence entries, part 812.
9612. gbvrl813.seq - Viral sequence entries, part 813.
9613. gbvrl814.seq - Viral sequence entries, part 814.
9614. gbvrl815.seq - Viral sequence entries, part 815.
9615. gbvrl816.seq - Viral sequence entries, part 816.
9616. gbvrl817.seq - Viral sequence entries, part 817.
9617. gbvrl818.seq - Viral sequence entries, part 818.
9618. gbvrl819.seq - Viral sequence entries, part 819.
9619. gbvrl82.seq - Viral sequence entries, part 82.
9620. gbvrl820.seq - Viral sequence entries, part 820.
9621. gbvrl821.seq - Viral sequence entries, part 821.
9622. gbvrl822.seq - Viral sequence entries, part 822.
9623. gbvrl823.seq - Viral sequence entries, part 823.
9624. gbvrl824.seq - Viral sequence entries, part 824.
9625. gbvrl825.seq - Viral sequence entries, part 825.
9626. gbvrl826.seq - Viral sequence entries, part 826.
9627. gbvrl827.seq - Viral sequence entries, part 827.
9628. gbvrl828.seq - Viral sequence entries, part 828.
9629. gbvrl829.seq - Viral sequence entries, part 829.
9630. gbvrl83.seq - Viral sequence entries, part 83.
9631. gbvrl830.seq - Viral sequence entries, part 830.
9632. gbvrl831.seq - Viral sequence entries, part 831.
9633. gbvrl832.seq - Viral sequence entries, part 832.
9634. gbvrl833.seq - Viral sequence entries, part 833.
9635. gbvrl834.seq - Viral sequence entries, part 834.
9636. gbvrl835.seq - Viral sequence entries, part 835.
9637. gbvrl836.seq - Viral sequence entries, part 836.
9638. gbvrl837.seq - Viral sequence entries, part 837.
9639. gbvrl838.seq - Viral sequence entries, part 838.
9640. gbvrl839.seq - Viral sequence entries, part 839.
9641. gbvrl84.seq - Viral sequence entries, part 84.
9642. gbvrl840.seq - Viral sequence entries, part 840.
9643. gbvrl841.seq - Viral sequence entries, part 841.
9644. gbvrl842.seq - Viral sequence entries, part 842.
9645. gbvrl843.seq - Viral sequence entries, part 843.
9646. gbvrl844.seq - Viral sequence entries, part 844.
9647. gbvrl845.seq - Viral sequence entries, part 845.
9648. gbvrl846.seq - Viral sequence entries, part 846.
9649. gbvrl847.seq - Viral sequence entries, part 847.
9650. gbvrl848.seq - Viral sequence entries, part 848.
9651. gbvrl849.seq - Viral sequence entries, part 849.
9652. gbvrl85.seq - Viral sequence entries, part 85.
9653. gbvrl850.seq - Viral sequence entries, part 850.
9654. gbvrl851.seq - Viral sequence entries, part 851.
9655. gbvrl852.seq - Viral sequence entries, part 852.
9656. gbvrl853.seq - Viral sequence entries, part 853.
9657. gbvrl854.seq - Viral sequence entries, part 854.
9658. gbvrl855.seq - Viral sequence entries, part 855.
9659. gbvrl856.seq - Viral sequence entries, part 856.
9660. gbvrl857.seq - Viral sequence entries, part 857.
9661. gbvrl858.seq - Viral sequence entries, part 858.
9662. gbvrl859.seq - Viral sequence entries, part 859.
9663. gbvrl86.seq - Viral sequence entries, part 86.
9664. gbvrl860.seq - Viral sequence entries, part 860.
9665. gbvrl861.seq - Viral sequence entries, part 861.
9666. gbvrl862.seq - Viral sequence entries, part 862.
9667. gbvrl863.seq - Viral sequence entries, part 863.
9668. gbvrl864.seq - Viral sequence entries, part 864.
9669. gbvrl865.seq - Viral sequence entries, part 865.
9670. gbvrl866.seq - Viral sequence entries, part 866.
9671. gbvrl867.seq - Viral sequence entries, part 867.
9672. gbvrl868.seq - Viral sequence entries, part 868.
9673. gbvrl869.seq - Viral sequence entries, part 869.
9674. gbvrl87.seq - Viral sequence entries, part 87.
9675. gbvrl870.seq - Viral sequence entries, part 870.
9676. gbvrl871.seq - Viral sequence entries, part 871.
9677. gbvrl872.seq - Viral sequence entries, part 872.
9678. gbvrl873.seq - Viral sequence entries, part 873.
9679. gbvrl874.seq - Viral sequence entries, part 874.
9680. gbvrl875.seq - Viral sequence entries, part 875.
9681. gbvrl876.seq - Viral sequence entries, part 876.
9682. gbvrl877.seq - Viral sequence entries, part 877.
9683. gbvrl878.seq - Viral sequence entries, part 878.
9684. gbvrl879.seq - Viral sequence entries, part 879.
9685. gbvrl88.seq - Viral sequence entries, part 88.
9686. gbvrl880.seq - Viral sequence entries, part 880.
9687. gbvrl881.seq - Viral sequence entries, part 881.
9688. gbvrl882.seq - Viral sequence entries, part 882.
9689. gbvrl883.seq - Viral sequence entries, part 883.
9690. gbvrl884.seq - Viral sequence entries, part 884.
9691. gbvrl885.seq - Viral sequence entries, part 885.
9692. gbvrl886.seq - Viral sequence entries, part 886.
9693. gbvrl887.seq - Viral sequence entries, part 887.
9694. gbvrl888.seq - Viral sequence entries, part 888.
9695. gbvrl889.seq - Viral sequence entries, part 889.
9696. gbvrl89.seq - Viral sequence entries, part 89.
9697. gbvrl890.seq - Viral sequence entries, part 890.
9698. gbvrl891.seq - Viral sequence entries, part 891.
9699. gbvrl892.seq - Viral sequence entries, part 892.
9700. gbvrl893.seq - Viral sequence entries, part 893.
9701. gbvrl894.seq - Viral sequence entries, part 894.
9702. gbvrl895.seq - Viral sequence entries, part 895.
9703. gbvrl896.seq - Viral sequence entries, part 896.
9704. gbvrl897.seq - Viral sequence entries, part 897.
9705. gbvrl898.seq - Viral sequence entries, part 898.
9706. gbvrl899.seq - Viral sequence entries, part 899.
9707. gbvrl9.seq - Viral sequence entries, part 9.
9708. gbvrl90.seq - Viral sequence entries, part 90.
9709. gbvrl900.seq - Viral sequence entries, part 900.
9710. gbvrl901.seq - Viral sequence entries, part 901.
9711. gbvrl902.seq - Viral sequence entries, part 902.
9712. gbvrl903.seq - Viral sequence entries, part 903.
9713. gbvrl904.seq - Viral sequence entries, part 904.
9714. gbvrl905.seq - Viral sequence entries, part 905.
9715. gbvrl906.seq - Viral sequence entries, part 906.
9716. gbvrl907.seq - Viral sequence entries, part 907.
9717. gbvrl908.seq - Viral sequence entries, part 908.
9718. gbvrl909.seq - Viral sequence entries, part 909.
9719. gbvrl91.seq - Viral sequence entries, part 91.
9720. gbvrl910.seq - Viral sequence entries, part 910.
9721. gbvrl911.seq - Viral sequence entries, part 911.
9722. gbvrl912.seq - Viral sequence entries, part 912.
9723. gbvrl913.seq - Viral sequence entries, part 913.
9724. gbvrl914.seq - Viral sequence entries, part 914.
9725. gbvrl915.seq - Viral sequence entries, part 915.
9726. gbvrl916.seq - Viral sequence entries, part 916.
9727. gbvrl917.seq - Viral sequence entries, part 917.
9728. gbvrl918.seq - Viral sequence entries, part 918.
9729. gbvrl919.seq - Viral sequence entries, part 919.
9730. gbvrl92.seq - Viral sequence entries, part 92.
9731. gbvrl920.seq - Viral sequence entries, part 920.
9732. gbvrl921.seq - Viral sequence entries, part 921.
9733. gbvrl922.seq - Viral sequence entries, part 922.
9734. gbvrl923.seq - Viral sequence entries, part 923.
9735. gbvrl924.seq - Viral sequence entries, part 924.
9736. gbvrl925.seq - Viral sequence entries, part 925.
9737. gbvrl926.seq - Viral sequence entries, part 926.
9738. gbvrl927.seq - Viral sequence entries, part 927.
9739. gbvrl928.seq - Viral sequence entries, part 928.
9740. gbvrl929.seq - Viral sequence entries, part 929.
9741. gbvrl93.seq - Viral sequence entries, part 93.
9742. gbvrl930.seq - Viral sequence entries, part 930.
9743. gbvrl931.seq - Viral sequence entries, part 931.
9744. gbvrl932.seq - Viral sequence entries, part 932.
9745. gbvrl933.seq - Viral sequence entries, part 933.
9746. gbvrl934.seq - Viral sequence entries, part 934.
9747. gbvrl935.seq - Viral sequence entries, part 935.
9748. gbvrl936.seq - Viral sequence entries, part 936.
9749. gbvrl937.seq - Viral sequence entries, part 937.
9750. gbvrl938.seq - Viral sequence entries, part 938.
9751. gbvrl939.seq - Viral sequence entries, part 939.
9752. gbvrl94.seq - Viral sequence entries, part 94.
9753. gbvrl940.seq - Viral sequence entries, part 940.
9754. gbvrl941.seq - Viral sequence entries, part 941.
9755. gbvrl942.seq - Viral sequence entries, part 942.
9756. gbvrl943.seq - Viral sequence entries, part 943.
9757. gbvrl944.seq - Viral sequence entries, part 944.
9758. gbvrl945.seq - Viral sequence entries, part 945.
9759. gbvrl946.seq - Viral sequence entries, part 946.
9760. gbvrl947.seq - Viral sequence entries, part 947.
9761. gbvrl948.seq - Viral sequence entries, part 948.
9762. gbvrl949.seq - Viral sequence entries, part 949.
9763. gbvrl95.seq - Viral sequence entries, part 95.
9764. gbvrl950.seq - Viral sequence entries, part 950.
9765. gbvrl951.seq - Viral sequence entries, part 951.
9766. gbvrl952.seq - Viral sequence entries, part 952.
9767. gbvrl953.seq - Viral sequence entries, part 953.
9768. gbvrl954.seq - Viral sequence entries, part 954.
9769. gbvrl955.seq - Viral sequence entries, part 955.
9770. gbvrl956.seq - Viral sequence entries, part 956.
9771. gbvrl957.seq - Viral sequence entries, part 957.
9772. gbvrl958.seq - Viral sequence entries, part 958.
9773. gbvrl959.seq - Viral sequence entries, part 959.
9774. gbvrl96.seq - Viral sequence entries, part 96.
9775. gbvrl960.seq - Viral sequence entries, part 960.
9776. gbvrl961.seq - Viral sequence entries, part 961.
9777. gbvrl962.seq - Viral sequence entries, part 962.
9778. gbvrl963.seq - Viral sequence entries, part 963.
9779. gbvrl964.seq - Viral sequence entries, part 964.
9780. gbvrl965.seq - Viral sequence entries, part 965.
9781. gbvrl966.seq - Viral sequence entries, part 966.
9782. gbvrl967.seq - Viral sequence entries, part 967.
9783. gbvrl968.seq - Viral sequence entries, part 968.
9784. gbvrl969.seq - Viral sequence entries, part 969.
9785. gbvrl97.seq - Viral sequence entries, part 97.
9786. gbvrl970.seq - Viral sequence entries, part 970.
9787. gbvrl971.seq - Viral sequence entries, part 971.
9788. gbvrl972.seq - Viral sequence entries, part 972.
9789. gbvrl973.seq - Viral sequence entries, part 973.
9790. gbvrl974.seq - Viral sequence entries, part 974.
9791. gbvrl975.seq - Viral sequence entries, part 975.
9792. gbvrl976.seq - Viral sequence entries, part 976.
9793. gbvrl977.seq - Viral sequence entries, part 977.
9794. gbvrl978.seq - Viral sequence entries, part 978.
9795. gbvrl979.seq - Viral sequence entries, part 979.
9796. gbvrl98.seq - Viral sequence entries, part 98.
9797. gbvrl980.seq - Viral sequence entries, part 980.
9798. gbvrl981.seq - Viral sequence entries, part 981.
9799. gbvrl982.seq - Viral sequence entries, part 982.
9800. gbvrl983.seq - Viral sequence entries, part 983.
9801. gbvrl984.seq - Viral sequence entries, part 984.
9802. gbvrl985.seq - Viral sequence entries, part 985.
9803. gbvrl986.seq - Viral sequence entries, part 986.
9804. gbvrl987.seq - Viral sequence entries, part 987.
9805. gbvrl988.seq - Viral sequence entries, part 988.
9806. gbvrl989.seq - Viral sequence entries, part 989.
9807. gbvrl99.seq - Viral sequence entries, part 99.
9808. gbvrl990.seq - Viral sequence entries, part 990.
9809. gbvrl991.seq - Viral sequence entries, part 991.
9810. gbvrl992.seq - Viral sequence entries, part 992.
9811. gbvrl993.seq - Viral sequence entries, part 993.
9812. gbvrl994.seq - Viral sequence entries, part 994.
9813. gbvrl995.seq - Viral sequence entries, part 995.
9814. gbvrl996.seq - Viral sequence entries, part 996.
9815. gbvrl997.seq - Viral sequence entries, part 997.
9816. gbvrl998.seq - Viral sequence entries, part 998.
9817. gbvrl999.seq - Viral sequence entries, part 999.
9818. gbvrt1.seq - Other vertebrate sequence entries, part 1.
9819. gbvrt10.seq - Other vertebrate sequence entries, part 10.
9820. gbvrt100.seq - Other vertebrate sequence entries, part 100.
9821. gbvrt101.seq - Other vertebrate sequence entries, part 101.
9822. gbvrt102.seq - Other vertebrate sequence entries, part 102.
9823. gbvrt103.seq - Other vertebrate sequence entries, part 103.
9824. gbvrt104.seq - Other vertebrate sequence entries, part 104.
9825. gbvrt105.seq - Other vertebrate sequence entries, part 105.
9826. gbvrt106.seq - Other vertebrate sequence entries, part 106.
9827. gbvrt107.seq - Other vertebrate sequence entries, part 107.
9828. gbvrt108.seq - Other vertebrate sequence entries, part 108.
9829. gbvrt109.seq - Other vertebrate sequence entries, part 109.
9830. gbvrt11.seq - Other vertebrate sequence entries, part 11.
9831. gbvrt110.seq - Other vertebrate sequence entries, part 110.
9832. gbvrt111.seq - Other vertebrate sequence entries, part 111.
9833. gbvrt112.seq - Other vertebrate sequence entries, part 112.
9834. gbvrt113.seq - Other vertebrate sequence entries, part 113.
9835. gbvrt114.seq - Other vertebrate sequence entries, part 114.
9836. gbvrt115.seq - Other vertebrate sequence entries, part 115.
9837. gbvrt116.seq - Other vertebrate sequence entries, part 116.
9838. gbvrt117.seq - Other vertebrate sequence entries, part 117.
9839. gbvrt118.seq - Other vertebrate sequence entries, part 118.
9840. gbvrt119.seq - Other vertebrate sequence entries, part 119.
9841. gbvrt12.seq - Other vertebrate sequence entries, part 12.
9842. gbvrt120.seq - Other vertebrate sequence entries, part 120.
9843. gbvrt121.seq - Other vertebrate sequence entries, part 121.
9844. gbvrt122.seq - Other vertebrate sequence entries, part 122.
9845. gbvrt123.seq - Other vertebrate sequence entries, part 123.
9846. gbvrt124.seq - Other vertebrate sequence entries, part 124.
9847. gbvrt125.seq - Other vertebrate sequence entries, part 125.
9848. gbvrt126.seq - Other vertebrate sequence entries, part 126.
9849. gbvrt127.seq - Other vertebrate sequence entries, part 127.
9850. gbvrt128.seq - Other vertebrate sequence entries, part 128.
9851. gbvrt129.seq - Other vertebrate sequence entries, part 129.
9852. gbvrt13.seq - Other vertebrate sequence entries, part 13.
9853. gbvrt130.seq - Other vertebrate sequence entries, part 130.
9854. gbvrt131.seq - Other vertebrate sequence entries, part 131.
9855. gbvrt132.seq - Other vertebrate sequence entries, part 132.
9856. gbvrt133.seq - Other vertebrate sequence entries, part 133.
9857. gbvrt134.seq - Other vertebrate sequence entries, part 134.
9858. gbvrt135.seq - Other vertebrate sequence entries, part 135.
9859. gbvrt136.seq - Other vertebrate sequence entries, part 136.
9860. gbvrt137.seq - Other vertebrate sequence entries, part 137.
9861. gbvrt138.seq - Other vertebrate sequence entries, part 138.
9862. gbvrt139.seq - Other vertebrate sequence entries, part 139.
9863. gbvrt14.seq - Other vertebrate sequence entries, part 14.
9864. gbvrt140.seq - Other vertebrate sequence entries, part 140.
9865. gbvrt141.seq - Other vertebrate sequence entries, part 141.
9866. gbvrt142.seq - Other vertebrate sequence entries, part 142.
9867. gbvrt143.seq - Other vertebrate sequence entries, part 143.
9868. gbvrt144.seq - Other vertebrate sequence entries, part 144.
9869. gbvrt145.seq - Other vertebrate sequence entries, part 145.
9870. gbvrt146.seq - Other vertebrate sequence entries, part 146.
9871. gbvrt147.seq - Other vertebrate sequence entries, part 147.
9872. gbvrt148.seq - Other vertebrate sequence entries, part 148.
9873. gbvrt149.seq - Other vertebrate sequence entries, part 149.
9874. gbvrt15.seq - Other vertebrate sequence entries, part 15.
9875. gbvrt150.seq - Other vertebrate sequence entries, part 150.
9876. gbvrt151.seq - Other vertebrate sequence entries, part 151.
9877. gbvrt152.seq - Other vertebrate sequence entries, part 152.
9878. gbvrt153.seq - Other vertebrate sequence entries, part 153.
9879. gbvrt154.seq - Other vertebrate sequence entries, part 154.
9880. gbvrt155.seq - Other vertebrate sequence entries, part 155.
9881. gbvrt156.seq - Other vertebrate sequence entries, part 156.
9882. gbvrt157.seq - Other vertebrate sequence entries, part 157.
9883. gbvrt158.seq - Other vertebrate sequence entries, part 158.
9884. gbvrt159.seq - Other vertebrate sequence entries, part 159.
9885. gbvrt16.seq - Other vertebrate sequence entries, part 16.
9886. gbvrt160.seq - Other vertebrate sequence entries, part 160.
9887. gbvrt161.seq - Other vertebrate sequence entries, part 161.
9888. gbvrt162.seq - Other vertebrate sequence entries, part 162.
9889. gbvrt163.seq - Other vertebrate sequence entries, part 163.
9890. gbvrt164.seq - Other vertebrate sequence entries, part 164.
9891. gbvrt165.seq - Other vertebrate sequence entries, part 165.
9892. gbvrt166.seq - Other vertebrate sequence entries, part 166.
9893. gbvrt167.seq - Other vertebrate sequence entries, part 167.
9894. gbvrt168.seq - Other vertebrate sequence entries, part 168.
9895. gbvrt169.seq - Other vertebrate sequence entries, part 169.
9896. gbvrt17.seq - Other vertebrate sequence entries, part 17.
9897. gbvrt170.seq - Other vertebrate sequence entries, part 170.
9898. gbvrt171.seq - Other vertebrate sequence entries, part 171.
9899. gbvrt172.seq - Other vertebrate sequence entries, part 172.
9900. gbvrt173.seq - Other vertebrate sequence entries, part 173.
9901. gbvrt174.seq - Other vertebrate sequence entries, part 174.
9902. gbvrt175.seq - Other vertebrate sequence entries, part 175.
9903. gbvrt176.seq - Other vertebrate sequence entries, part 176.
9904. gbvrt177.seq - Other vertebrate sequence entries, part 177.
9905. gbvrt178.seq - Other vertebrate sequence entries, part 178.
9906. gbvrt179.seq - Other vertebrate sequence entries, part 179.
9907. gbvrt18.seq - Other vertebrate sequence entries, part 18.
9908. gbvrt180.seq - Other vertebrate sequence entries, part 180.
9909. gbvrt181.seq - Other vertebrate sequence entries, part 181.
9910. gbvrt182.seq - Other vertebrate sequence entries, part 182.
9911. gbvrt183.seq - Other vertebrate sequence entries, part 183.
9912. gbvrt184.seq - Other vertebrate sequence entries, part 184.
9913. gbvrt185.seq - Other vertebrate sequence entries, part 185.
9914. gbvrt186.seq - Other vertebrate sequence entries, part 186.
9915. gbvrt187.seq - Other vertebrate sequence entries, part 187.
9916. gbvrt188.seq - Other vertebrate sequence entries, part 188.
9917. gbvrt189.seq - Other vertebrate sequence entries, part 189.
9918. gbvrt19.seq - Other vertebrate sequence entries, part 19.
9919. gbvrt190.seq - Other vertebrate sequence entries, part 190.
9920. gbvrt191.seq - Other vertebrate sequence entries, part 191.
9921. gbvrt192.seq - Other vertebrate sequence entries, part 192.
9922. gbvrt193.seq - Other vertebrate sequence entries, part 193.
9923. gbvrt194.seq - Other vertebrate sequence entries, part 194.
9924. gbvrt195.seq - Other vertebrate sequence entries, part 195.
9925. gbvrt196.seq - Other vertebrate sequence entries, part 196.
9926. gbvrt197.seq - Other vertebrate sequence entries, part 197.
9927. gbvrt198.seq - Other vertebrate sequence entries, part 198.
9928. gbvrt199.seq - Other vertebrate sequence entries, part 199.
9929. gbvrt2.seq - Other vertebrate sequence entries, part 2.
9930. gbvrt20.seq - Other vertebrate sequence entries, part 20.
9931. gbvrt200.seq - Other vertebrate sequence entries, part 200.
9932. gbvrt201.seq - Other vertebrate sequence entries, part 201.
9933. gbvrt202.seq - Other vertebrate sequence entries, part 202.
9934. gbvrt203.seq - Other vertebrate sequence entries, part 203.
9935. gbvrt204.seq - Other vertebrate sequence entries, part 204.
9936. gbvrt205.seq - Other vertebrate sequence entries, part 205.
9937. gbvrt206.seq - Other vertebrate sequence entries, part 206.
9938. gbvrt207.seq - Other vertebrate sequence entries, part 207.
9939. gbvrt208.seq - Other vertebrate sequence entries, part 208.
9940. gbvrt209.seq - Other vertebrate sequence entries, part 209.
9941. gbvrt21.seq - Other vertebrate sequence entries, part 21.
9942. gbvrt210.seq - Other vertebrate sequence entries, part 210.
9943. gbvrt211.seq - Other vertebrate sequence entries, part 211.
9944. gbvrt212.seq - Other vertebrate sequence entries, part 212.
9945. gbvrt213.seq - Other vertebrate sequence entries, part 213.
9946. gbvrt214.seq - Other vertebrate sequence entries, part 214.
9947. gbvrt215.seq - Other vertebrate sequence entries, part 215.
9948. gbvrt216.seq - Other vertebrate sequence entries, part 216.
9949. gbvrt217.seq - Other vertebrate sequence entries, part 217.
9950. gbvrt218.seq - Other vertebrate sequence entries, part 218.
9951. gbvrt219.seq - Other vertebrate sequence entries, part 219.
9952. gbvrt22.seq - Other vertebrate sequence entries, part 22.
9953. gbvrt220.seq - Other vertebrate sequence entries, part 220.
9954. gbvrt221.seq - Other vertebrate sequence entries, part 221.
9955. gbvrt222.seq - Other vertebrate sequence entries, part 222.
9956. gbvrt223.seq - Other vertebrate sequence entries, part 223.
9957. gbvrt224.seq - Other vertebrate sequence entries, part 224.
9958. gbvrt225.seq - Other vertebrate sequence entries, part 225.
9959. gbvrt226.seq - Other vertebrate sequence entries, part 226.
9960. gbvrt227.seq - Other vertebrate sequence entries, part 227.
9961. gbvrt228.seq - Other vertebrate sequence entries, part 228.
9962. gbvrt229.seq - Other vertebrate sequence entries, part 229.
9963. gbvrt23.seq - Other vertebrate sequence entries, part 23.
9964. gbvrt230.seq - Other vertebrate sequence entries, part 230.
9965. gbvrt231.seq - Other vertebrate sequence entries, part 231.
9966. gbvrt232.seq - Other vertebrate sequence entries, part 232.
9967. gbvrt233.seq - Other vertebrate sequence entries, part 233.
9968. gbvrt234.seq - Other vertebrate sequence entries, part 234.
9969. gbvrt235.seq - Other vertebrate sequence entries, part 235.
9970. gbvrt236.seq - Other vertebrate sequence entries, part 236.
9971. gbvrt237.seq - Other vertebrate sequence entries, part 237.
9972. gbvrt238.seq - Other vertebrate sequence entries, part 238.
9973. gbvrt239.seq - Other vertebrate sequence entries, part 239.
9974. gbvrt24.seq - Other vertebrate sequence entries, part 24.
9975. gbvrt240.seq - Other vertebrate sequence entries, part 240.
9976. gbvrt241.seq - Other vertebrate sequence entries, part 241.
9977. gbvrt242.seq - Other vertebrate sequence entries, part 242.
9978. gbvrt243.seq - Other vertebrate sequence entries, part 243.
9979. gbvrt244.seq - Other vertebrate sequence entries, part 244.
9980. gbvrt245.seq - Other vertebrate sequence entries, part 245.
9981. gbvrt246.seq - Other vertebrate sequence entries, part 246.
9982. gbvrt247.seq - Other vertebrate sequence entries, part 247.
9983. gbvrt248.seq - Other vertebrate sequence entries, part 248.
9984. gbvrt249.seq - Other vertebrate sequence entries, part 249.
9985. gbvrt25.seq - Other vertebrate sequence entries, part 25.
9986. gbvrt250.seq - Other vertebrate sequence entries, part 250.
9987. gbvrt251.seq - Other vertebrate sequence entries, part 251.
9988. gbvrt252.seq - Other vertebrate sequence entries, part 252.
9989. gbvrt253.seq - Other vertebrate sequence entries, part 253.
9990. gbvrt254.seq - Other vertebrate sequence entries, part 254.
9991. gbvrt255.seq - Other vertebrate sequence entries, part 255.
9992. gbvrt256.seq - Other vertebrate sequence entries, part 256.
9993. gbvrt257.seq - Other vertebrate sequence entries, part 257.
9994. gbvrt258.seq - Other vertebrate sequence entries, part 258.
9995. gbvrt259.seq - Other vertebrate sequence entries, part 259.
9996. gbvrt26.seq - Other vertebrate sequence entries, part 26.
9997. gbvrt260.seq - Other vertebrate sequence entries, part 260.
9998. gbvrt261.seq - Other vertebrate sequence entries, part 261.
9999. gbvrt262.seq - Other vertebrate sequence entries, part 262.
10000. gbvrt263.seq - Other vertebrate sequence entries, part 263.
10001. gbvrt264.seq - Other vertebrate sequence entries, part 264.
10002. gbvrt265.seq - Other vertebrate sequence entries, part 265.
10003. gbvrt266.seq - Other vertebrate sequence entries, part 266.
10004. gbvrt267.seq - Other vertebrate sequence entries, part 267.
10005. gbvrt268.seq - Other vertebrate sequence entries, part 268.
10006. gbvrt269.seq - Other vertebrate sequence entries, part 269.
10007. gbvrt27.seq - Other vertebrate sequence entries, part 27.
10008. gbvrt270.seq - Other vertebrate sequence entries, part 270.
10009. gbvrt271.seq - Other vertebrate sequence entries, part 271.
10010. gbvrt272.seq - Other vertebrate sequence entries, part 272.
10011. gbvrt273.seq - Other vertebrate sequence entries, part 273.
10012. gbvrt274.seq - Other vertebrate sequence entries, part 274.
10013. gbvrt275.seq - Other vertebrate sequence entries, part 275.
10014. gbvrt276.seq - Other vertebrate sequence entries, part 276.
10015. gbvrt277.seq - Other vertebrate sequence entries, part 277.
10016. gbvrt278.seq - Other vertebrate sequence entries, part 278.
10017. gbvrt279.seq - Other vertebrate sequence entries, part 279.
10018. gbvrt28.seq - Other vertebrate sequence entries, part 28.
10019. gbvrt280.seq - Other vertebrate sequence entries, part 280.
10020. gbvrt281.seq - Other vertebrate sequence entries, part 281.
10021. gbvrt282.seq - Other vertebrate sequence entries, part 282.
10022. gbvrt283.seq - Other vertebrate sequence entries, part 283.
10023. gbvrt284.seq - Other vertebrate sequence entries, part 284.
10024. gbvrt285.seq - Other vertebrate sequence entries, part 285.
10025. gbvrt286.seq - Other vertebrate sequence entries, part 286.
10026. gbvrt287.seq - Other vertebrate sequence entries, part 287.
10027. gbvrt288.seq - Other vertebrate sequence entries, part 288.
10028. gbvrt289.seq - Other vertebrate sequence entries, part 289.
10029. gbvrt29.seq - Other vertebrate sequence entries, part 29.
10030. gbvrt290.seq - Other vertebrate sequence entries, part 290.
10031. gbvrt291.seq - Other vertebrate sequence entries, part 291.
10032. gbvrt292.seq - Other vertebrate sequence entries, part 292.
10033. gbvrt293.seq - Other vertebrate sequence entries, part 293.
10034. gbvrt294.seq - Other vertebrate sequence entries, part 294.
10035. gbvrt295.seq - Other vertebrate sequence entries, part 295.
10036. gbvrt296.seq - Other vertebrate sequence entries, part 296.
10037. gbvrt297.seq - Other vertebrate sequence entries, part 297.
10038. gbvrt298.seq - Other vertebrate sequence entries, part 298.
10039. gbvrt299.seq - Other vertebrate sequence entries, part 299.
10040. gbvrt3.seq - Other vertebrate sequence entries, part 3.
10041. gbvrt30.seq - Other vertebrate sequence entries, part 30.
10042. gbvrt300.seq - Other vertebrate sequence entries, part 300.
10043. gbvrt301.seq - Other vertebrate sequence entries, part 301.
10044. gbvrt302.seq - Other vertebrate sequence entries, part 302.
10045. gbvrt303.seq - Other vertebrate sequence entries, part 303.
10046. gbvrt304.seq - Other vertebrate sequence entries, part 304.
10047. gbvrt305.seq - Other vertebrate sequence entries, part 305.
10048. gbvrt306.seq - Other vertebrate sequence entries, part 306.
10049. gbvrt307.seq - Other vertebrate sequence entries, part 307.
10050. gbvrt308.seq - Other vertebrate sequence entries, part 308.
10051. gbvrt309.seq - Other vertebrate sequence entries, part 309.
10052. gbvrt31.seq - Other vertebrate sequence entries, part 31.
10053. gbvrt310.seq - Other vertebrate sequence entries, part 310.
10054. gbvrt311.seq - Other vertebrate sequence entries, part 311.
10055. gbvrt312.seq - Other vertebrate sequence entries, part 312.
10056. gbvrt313.seq - Other vertebrate sequence entries, part 313.
10057. gbvrt314.seq - Other vertebrate sequence entries, part 314.
10058. gbvrt315.seq - Other vertebrate sequence entries, part 315.
10059. gbvrt316.seq - Other vertebrate sequence entries, part 316.
10060. gbvrt317.seq - Other vertebrate sequence entries, part 317.
10061. gbvrt318.seq - Other vertebrate sequence entries, part 318.
10062. gbvrt319.seq - Other vertebrate sequence entries, part 319.
10063. gbvrt32.seq - Other vertebrate sequence entries, part 32.
10064. gbvrt320.seq - Other vertebrate sequence entries, part 320.
10065. gbvrt321.seq - Other vertebrate sequence entries, part 321.
10066. gbvrt322.seq - Other vertebrate sequence entries, part 322.
10067. gbvrt323.seq - Other vertebrate sequence entries, part 323.
10068. gbvrt324.seq - Other vertebrate sequence entries, part 324.
10069. gbvrt325.seq - Other vertebrate sequence entries, part 325.
10070. gbvrt326.seq - Other vertebrate sequence entries, part 326.
10071. gbvrt327.seq - Other vertebrate sequence entries, part 327.
10072. gbvrt328.seq - Other vertebrate sequence entries, part 328.
10073. gbvrt329.seq - Other vertebrate sequence entries, part 329.
10074. gbvrt33.seq - Other vertebrate sequence entries, part 33.
10075. gbvrt330.seq - Other vertebrate sequence entries, part 330.
10076. gbvrt331.seq - Other vertebrate sequence entries, part 331.
10077. gbvrt332.seq - Other vertebrate sequence entries, part 332.
10078. gbvrt333.seq - Other vertebrate sequence entries, part 333.
10079. gbvrt334.seq - Other vertebrate sequence entries, part 334.
10080. gbvrt335.seq - Other vertebrate sequence entries, part 335.
10081. gbvrt336.seq - Other vertebrate sequence entries, part 336.
10082. gbvrt337.seq - Other vertebrate sequence entries, part 337.
10083. gbvrt338.seq - Other vertebrate sequence entries, part 338.
10084. gbvrt339.seq - Other vertebrate sequence entries, part 339.
10085. gbvrt34.seq - Other vertebrate sequence entries, part 34.
10086. gbvrt340.seq - Other vertebrate sequence entries, part 340.
10087. gbvrt341.seq - Other vertebrate sequence entries, part 341.
10088. gbvrt342.seq - Other vertebrate sequence entries, part 342.
10089. gbvrt343.seq - Other vertebrate sequence entries, part 343.
10090. gbvrt344.seq - Other vertebrate sequence entries, part 344.
10091. gbvrt345.seq - Other vertebrate sequence entries, part 345.
10092. gbvrt346.seq - Other vertebrate sequence entries, part 346.
10093. gbvrt347.seq - Other vertebrate sequence entries, part 347.
10094. gbvrt348.seq - Other vertebrate sequence entries, part 348.
10095. gbvrt349.seq - Other vertebrate sequence entries, part 349.
10096. gbvrt35.seq - Other vertebrate sequence entries, part 35.
10097. gbvrt350.seq - Other vertebrate sequence entries, part 350.
10098. gbvrt351.seq - Other vertebrate sequence entries, part 351.
10099. gbvrt352.seq - Other vertebrate sequence entries, part 352.
10100. gbvrt353.seq - Other vertebrate sequence entries, part 353.
10101. gbvrt354.seq - Other vertebrate sequence entries, part 354.
10102. gbvrt355.seq - Other vertebrate sequence entries, part 355.
10103. gbvrt356.seq - Other vertebrate sequence entries, part 356.
10104. gbvrt357.seq - Other vertebrate sequence entries, part 357.
10105. gbvrt358.seq - Other vertebrate sequence entries, part 358.
10106. gbvrt359.seq - Other vertebrate sequence entries, part 359.
10107. gbvrt36.seq - Other vertebrate sequence entries, part 36.
10108. gbvrt360.seq - Other vertebrate sequence entries, part 360.
10109. gbvrt361.seq - Other vertebrate sequence entries, part 361.
10110. gbvrt362.seq - Other vertebrate sequence entries, part 362.
10111. gbvrt363.seq - Other vertebrate sequence entries, part 363.
10112. gbvrt364.seq - Other vertebrate sequence entries, part 364.
10113. gbvrt365.seq - Other vertebrate sequence entries, part 365.
10114. gbvrt366.seq - Other vertebrate sequence entries, part 366.
10115. gbvrt367.seq - Other vertebrate sequence entries, part 367.
10116. gbvrt368.seq - Other vertebrate sequence entries, part 368.
10117. gbvrt369.seq - Other vertebrate sequence entries, part 369.
10118. gbvrt37.seq - Other vertebrate sequence entries, part 37.
10119. gbvrt370.seq - Other vertebrate sequence entries, part 370.
10120. gbvrt371.seq - Other vertebrate sequence entries, part 371.
10121. gbvrt372.seq - Other vertebrate sequence entries, part 372.
10122. gbvrt373.seq - Other vertebrate sequence entries, part 373.
10123. gbvrt374.seq - Other vertebrate sequence entries, part 374.
10124. gbvrt375.seq - Other vertebrate sequence entries, part 375.
10125. gbvrt376.seq - Other vertebrate sequence entries, part 376.
10126. gbvrt377.seq - Other vertebrate sequence entries, part 377.
10127. gbvrt378.seq - Other vertebrate sequence entries, part 378.
10128. gbvrt379.seq - Other vertebrate sequence entries, part 379.
10129. gbvrt38.seq - Other vertebrate sequence entries, part 38.
10130. gbvrt380.seq - Other vertebrate sequence entries, part 380.
10131. gbvrt381.seq - Other vertebrate sequence entries, part 381.
10132. gbvrt382.seq - Other vertebrate sequence entries, part 382.
10133. gbvrt383.seq - Other vertebrate sequence entries, part 383.
10134. gbvrt384.seq - Other vertebrate sequence entries, part 384.
10135. gbvrt385.seq - Other vertebrate sequence entries, part 385.
10136. gbvrt386.seq - Other vertebrate sequence entries, part 386.
10137. gbvrt387.seq - Other vertebrate sequence entries, part 387.
10138. gbvrt388.seq - Other vertebrate sequence entries, part 388.
10139. gbvrt389.seq - Other vertebrate sequence entries, part 389.
10140. gbvrt39.seq - Other vertebrate sequence entries, part 39.
10141. gbvrt390.seq - Other vertebrate sequence entries, part 390.
10142. gbvrt391.seq - Other vertebrate sequence entries, part 391.
10143. gbvrt392.seq - Other vertebrate sequence entries, part 392.
10144. gbvrt393.seq - Other vertebrate sequence entries, part 393.
10145. gbvrt394.seq - Other vertebrate sequence entries, part 394.
10146. gbvrt395.seq - Other vertebrate sequence entries, part 395.
10147. gbvrt396.seq - Other vertebrate sequence entries, part 396.
10148. gbvrt397.seq - Other vertebrate sequence entries, part 397.
10149. gbvrt398.seq - Other vertebrate sequence entries, part 398.
10150. gbvrt399.seq - Other vertebrate sequence entries, part 399.
10151. gbvrt4.seq - Other vertebrate sequence entries, part 4.
10152. gbvrt40.seq - Other vertebrate sequence entries, part 40.
10153. gbvrt400.seq - Other vertebrate sequence entries, part 400.
10154. gbvrt401.seq - Other vertebrate sequence entries, part 401.
10155. gbvrt402.seq - Other vertebrate sequence entries, part 402.
10156. gbvrt403.seq - Other vertebrate sequence entries, part 403.
10157. gbvrt404.seq - Other vertebrate sequence entries, part 404.
10158. gbvrt405.seq - Other vertebrate sequence entries, part 405.
10159. gbvrt406.seq - Other vertebrate sequence entries, part 406.
10160. gbvrt407.seq - Other vertebrate sequence entries, part 407.
10161. gbvrt408.seq - Other vertebrate sequence entries, part 408.
10162. gbvrt409.seq - Other vertebrate sequence entries, part 409.
10163. gbvrt41.seq - Other vertebrate sequence entries, part 41.
10164. gbvrt410.seq - Other vertebrate sequence entries, part 410.
10165. gbvrt411.seq - Other vertebrate sequence entries, part 411.
10166. gbvrt412.seq - Other vertebrate sequence entries, part 412.
10167. gbvrt413.seq - Other vertebrate sequence entries, part 413.
10168. gbvrt414.seq - Other vertebrate sequence entries, part 414.
10169. gbvrt415.seq - Other vertebrate sequence entries, part 415.
10170. gbvrt416.seq - Other vertebrate sequence entries, part 416.
10171. gbvrt417.seq - Other vertebrate sequence entries, part 417.
10172. gbvrt418.seq - Other vertebrate sequence entries, part 418.
10173. gbvrt419.seq - Other vertebrate sequence entries, part 419.
10174. gbvrt42.seq - Other vertebrate sequence entries, part 42.
10175. gbvrt420.seq - Other vertebrate sequence entries, part 420.
10176. gbvrt421.seq - Other vertebrate sequence entries, part 421.
10177. gbvrt422.seq - Other vertebrate sequence entries, part 422.
10178. gbvrt423.seq - Other vertebrate sequence entries, part 423.
10179. gbvrt424.seq - Other vertebrate sequence entries, part 424.
10180. gbvrt425.seq - Other vertebrate sequence entries, part 425.
10181. gbvrt426.seq - Other vertebrate sequence entries, part 426.
10182. gbvrt427.seq - Other vertebrate sequence entries, part 427.
10183. gbvrt428.seq - Other vertebrate sequence entries, part 428.
10184. gbvrt429.seq - Other vertebrate sequence entries, part 429.
10185. gbvrt43.seq - Other vertebrate sequence entries, part 43.
10186. gbvrt430.seq - Other vertebrate sequence entries, part 430.
10187. gbvrt431.seq - Other vertebrate sequence entries, part 431.
10188. gbvrt432.seq - Other vertebrate sequence entries, part 432.
10189. gbvrt433.seq - Other vertebrate sequence entries, part 433.
10190. gbvrt434.seq - Other vertebrate sequence entries, part 434.
10191. gbvrt435.seq - Other vertebrate sequence entries, part 435.
10192. gbvrt436.seq - Other vertebrate sequence entries, part 436.
10193. gbvrt437.seq - Other vertebrate sequence entries, part 437.
10194. gbvrt438.seq - Other vertebrate sequence entries, part 438.
10195. gbvrt439.seq - Other vertebrate sequence entries, part 439.
10196. gbvrt44.seq - Other vertebrate sequence entries, part 44.
10197. gbvrt440.seq - Other vertebrate sequence entries, part 440.
10198. gbvrt441.seq - Other vertebrate sequence entries, part 441.
10199. gbvrt442.seq - Other vertebrate sequence entries, part 442.
10200. gbvrt443.seq - Other vertebrate sequence entries, part 443.
10201. gbvrt444.seq - Other vertebrate sequence entries, part 444.
10202. gbvrt445.seq - Other vertebrate sequence entries, part 445.
10203. gbvrt446.seq - Other vertebrate sequence entries, part 446.
10204. gbvrt447.seq - Other vertebrate sequence entries, part 447.
10205. gbvrt448.seq - Other vertebrate sequence entries, part 448.
10206. gbvrt449.seq - Other vertebrate sequence entries, part 449.
10207. gbvrt45.seq - Other vertebrate sequence entries, part 45.
10208. gbvrt450.seq - Other vertebrate sequence entries, part 450.
10209. gbvrt451.seq - Other vertebrate sequence entries, part 451.
10210. gbvrt452.seq - Other vertebrate sequence entries, part 452.
10211. gbvrt453.seq - Other vertebrate sequence entries, part 453.
10212. gbvrt454.seq - Other vertebrate sequence entries, part 454.
10213. gbvrt455.seq - Other vertebrate sequence entries, part 455.
10214. gbvrt456.seq - Other vertebrate sequence entries, part 456.
10215. gbvrt457.seq - Other vertebrate sequence entries, part 457.
10216. gbvrt458.seq - Other vertebrate sequence entries, part 458.
10217. gbvrt459.seq - Other vertebrate sequence entries, part 459.
10218. gbvrt46.seq - Other vertebrate sequence entries, part 46.
10219. gbvrt460.seq - Other vertebrate sequence entries, part 460.
10220. gbvrt461.seq - Other vertebrate sequence entries, part 461.
10221. gbvrt462.seq - Other vertebrate sequence entries, part 462.
10222. gbvrt463.seq - Other vertebrate sequence entries, part 463.
10223. gbvrt464.seq - Other vertebrate sequence entries, part 464.
10224. gbvrt465.seq - Other vertebrate sequence entries, part 465.
10225. gbvrt466.seq - Other vertebrate sequence entries, part 466.
10226. gbvrt467.seq - Other vertebrate sequence entries, part 467.
10227. gbvrt468.seq - Other vertebrate sequence entries, part 468.
10228. gbvrt469.seq - Other vertebrate sequence entries, part 469.
10229. gbvrt47.seq - Other vertebrate sequence entries, part 47.
10230. gbvrt470.seq - Other vertebrate sequence entries, part 470.
10231. gbvrt471.seq - Other vertebrate sequence entries, part 471.
10232. gbvrt472.seq - Other vertebrate sequence entries, part 472.
10233. gbvrt473.seq - Other vertebrate sequence entries, part 473.
10234. gbvrt474.seq - Other vertebrate sequence entries, part 474.
10235. gbvrt475.seq - Other vertebrate sequence entries, part 475.
10236. gbvrt476.seq - Other vertebrate sequence entries, part 476.
10237. gbvrt477.seq - Other vertebrate sequence entries, part 477.
10238. gbvrt478.seq - Other vertebrate sequence entries, part 478.
10239. gbvrt479.seq - Other vertebrate sequence entries, part 479.
10240. gbvrt48.seq - Other vertebrate sequence entries, part 48.
10241. gbvrt480.seq - Other vertebrate sequence entries, part 480.
10242. gbvrt481.seq - Other vertebrate sequence entries, part 481.
10243. gbvrt482.seq - Other vertebrate sequence entries, part 482.
10244. gbvrt483.seq - Other vertebrate sequence entries, part 483.
10245. gbvrt484.seq - Other vertebrate sequence entries, part 484.
10246. gbvrt485.seq - Other vertebrate sequence entries, part 485.
10247. gbvrt486.seq - Other vertebrate sequence entries, part 486.
10248. gbvrt487.seq - Other vertebrate sequence entries, part 487.
10249. gbvrt488.seq - Other vertebrate sequence entries, part 488.
10250. gbvrt489.seq - Other vertebrate sequence entries, part 489.
10251. gbvrt49.seq - Other vertebrate sequence entries, part 49.
10252. gbvrt490.seq - Other vertebrate sequence entries, part 490.
10253. gbvrt491.seq - Other vertebrate sequence entries, part 491.
10254. gbvrt492.seq - Other vertebrate sequence entries, part 492.
10255. gbvrt493.seq - Other vertebrate sequence entries, part 493.
10256. gbvrt494.seq - Other vertebrate sequence entries, part 494.
10257. gbvrt495.seq - Other vertebrate sequence entries, part 495.
10258. gbvrt496.seq - Other vertebrate sequence entries, part 496.
10259. gbvrt497.seq - Other vertebrate sequence entries, part 497.
10260. gbvrt498.seq - Other vertebrate sequence entries, part 498.
10261. gbvrt499.seq - Other vertebrate sequence entries, part 499.
10262. gbvrt5.seq - Other vertebrate sequence entries, part 5.
10263. gbvrt50.seq - Other vertebrate sequence entries, part 50.
10264. gbvrt500.seq - Other vertebrate sequence entries, part 500.
10265. gbvrt501.seq - Other vertebrate sequence entries, part 501.
10266. gbvrt502.seq - Other vertebrate sequence entries, part 502.
10267. gbvrt503.seq - Other vertebrate sequence entries, part 503.
10268. gbvrt504.seq - Other vertebrate sequence entries, part 504.
10269. gbvrt505.seq - Other vertebrate sequence entries, part 505.
10270. gbvrt506.seq - Other vertebrate sequence entries, part 506.
10271. gbvrt507.seq - Other vertebrate sequence entries, part 507.
10272. gbvrt508.seq - Other vertebrate sequence entries, part 508.
10273. gbvrt509.seq - Other vertebrate sequence entries, part 509.
10274. gbvrt51.seq - Other vertebrate sequence entries, part 51.
10275. gbvrt510.seq - Other vertebrate sequence entries, part 510.
10276. gbvrt511.seq - Other vertebrate sequence entries, part 511.
10277. gbvrt512.seq - Other vertebrate sequence entries, part 512.
10278. gbvrt513.seq - Other vertebrate sequence entries, part 513.
10279. gbvrt514.seq - Other vertebrate sequence entries, part 514.
10280. gbvrt515.seq - Other vertebrate sequence entries, part 515.
10281. gbvrt516.seq - Other vertebrate sequence entries, part 516.
10282. gbvrt517.seq - Other vertebrate sequence entries, part 517.
10283. gbvrt518.seq - Other vertebrate sequence entries, part 518.
10284. gbvrt519.seq - Other vertebrate sequence entries, part 519.
10285. gbvrt52.seq - Other vertebrate sequence entries, part 52.
10286. gbvrt520.seq - Other vertebrate sequence entries, part 520.
10287. gbvrt521.seq - Other vertebrate sequence entries, part 521.
10288. gbvrt522.seq - Other vertebrate sequence entries, part 522.
10289. gbvrt523.seq - Other vertebrate sequence entries, part 523.
10290. gbvrt524.seq - Other vertebrate sequence entries, part 524.
10291. gbvrt525.seq - Other vertebrate sequence entries, part 525.
10292. gbvrt526.seq - Other vertebrate sequence entries, part 526.
10293. gbvrt527.seq - Other vertebrate sequence entries, part 527.
10294. gbvrt528.seq - Other vertebrate sequence entries, part 528.
10295. gbvrt529.seq - Other vertebrate sequence entries, part 529.
10296. gbvrt53.seq - Other vertebrate sequence entries, part 53.
10297. gbvrt530.seq - Other vertebrate sequence entries, part 530.
10298. gbvrt531.seq - Other vertebrate sequence entries, part 531.
10299. gbvrt532.seq - Other vertebrate sequence entries, part 532.
10300. gbvrt533.seq - Other vertebrate sequence entries, part 533.
10301. gbvrt534.seq - Other vertebrate sequence entries, part 534.
10302. gbvrt535.seq - Other vertebrate sequence entries, part 535.
10303. gbvrt536.seq - Other vertebrate sequence entries, part 536.
10304. gbvrt537.seq - Other vertebrate sequence entries, part 537.
10305. gbvrt538.seq - Other vertebrate sequence entries, part 538.
10306. gbvrt539.seq - Other vertebrate sequence entries, part 539.
10307. gbvrt54.seq - Other vertebrate sequence entries, part 54.
10308. gbvrt540.seq - Other vertebrate sequence entries, part 540.
10309. gbvrt541.seq - Other vertebrate sequence entries, part 541.
10310. gbvrt542.seq - Other vertebrate sequence entries, part 542.
10311. gbvrt543.seq - Other vertebrate sequence entries, part 543.
10312. gbvrt544.seq - Other vertebrate sequence entries, part 544.
10313. gbvrt545.seq - Other vertebrate sequence entries, part 545.
10314. gbvrt546.seq - Other vertebrate sequence entries, part 546.
10315. gbvrt547.seq - Other vertebrate sequence entries, part 547.
10316. gbvrt548.seq - Other vertebrate sequence entries, part 548.
10317. gbvrt549.seq - Other vertebrate sequence entries, part 549.
10318. gbvrt55.seq - Other vertebrate sequence entries, part 55.
10319. gbvrt550.seq - Other vertebrate sequence entries, part 550.
10320. gbvrt551.seq - Other vertebrate sequence entries, part 551.
10321. gbvrt552.seq - Other vertebrate sequence entries, part 552.
10322. gbvrt553.seq - Other vertebrate sequence entries, part 553.
10323. gbvrt554.seq - Other vertebrate sequence entries, part 554.
10324. gbvrt555.seq - Other vertebrate sequence entries, part 555.
10325. gbvrt556.seq - Other vertebrate sequence entries, part 556.
10326. gbvrt557.seq - Other vertebrate sequence entries, part 557.
10327. gbvrt558.seq - Other vertebrate sequence entries, part 558.
10328. gbvrt559.seq - Other vertebrate sequence entries, part 559.
10329. gbvrt56.seq - Other vertebrate sequence entries, part 56.
10330. gbvrt560.seq - Other vertebrate sequence entries, part 560.
10331. gbvrt561.seq - Other vertebrate sequence entries, part 561.
10332. gbvrt562.seq - Other vertebrate sequence entries, part 562.
10333. gbvrt563.seq - Other vertebrate sequence entries, part 563.
10334. gbvrt564.seq - Other vertebrate sequence entries, part 564.
10335. gbvrt565.seq - Other vertebrate sequence entries, part 565.
10336. gbvrt566.seq - Other vertebrate sequence entries, part 566.
10337. gbvrt567.seq - Other vertebrate sequence entries, part 567.
10338. gbvrt568.seq - Other vertebrate sequence entries, part 568.
10339. gbvrt569.seq - Other vertebrate sequence entries, part 569.
10340. gbvrt57.seq - Other vertebrate sequence entries, part 57.
10341. gbvrt570.seq - Other vertebrate sequence entries, part 570.
10342. gbvrt571.seq - Other vertebrate sequence entries, part 571.
10343. gbvrt572.seq - Other vertebrate sequence entries, part 572.
10344. gbvrt573.seq - Other vertebrate sequence entries, part 573.
10345. gbvrt574.seq - Other vertebrate sequence entries, part 574.
10346. gbvrt575.seq - Other vertebrate sequence entries, part 575.
10347. gbvrt58.seq - Other vertebrate sequence entries, part 58.
10348. gbvrt59.seq - Other vertebrate sequence entries, part 59.
10349. gbvrt6.seq - Other vertebrate sequence entries, part 6.
10350. gbvrt60.seq - Other vertebrate sequence entries, part 60.
10351. gbvrt61.seq - Other vertebrate sequence entries, part 61.
10352. gbvrt62.seq - Other vertebrate sequence entries, part 62.
10353. gbvrt63.seq - Other vertebrate sequence entries, part 63.
10354. gbvrt64.seq - Other vertebrate sequence entries, part 64.
10355. gbvrt65.seq - Other vertebrate sequence entries, part 65.
10356. gbvrt66.seq - Other vertebrate sequence entries, part 66.
10357. gbvrt67.seq - Other vertebrate sequence entries, part 67.
10358. gbvrt68.seq - Other vertebrate sequence entries, part 68.
10359. gbvrt69.seq - Other vertebrate sequence entries, part 69.
10360. gbvrt7.seq - Other vertebrate sequence entries, part 7.
10361. gbvrt70.seq - Other vertebrate sequence entries, part 70.
10362. gbvrt71.seq - Other vertebrate sequence entries, part 71.
10363. gbvrt72.seq - Other vertebrate sequence entries, part 72.
10364. gbvrt73.seq - Other vertebrate sequence entries, part 73.
10365. gbvrt74.seq - Other vertebrate sequence entries, part 74.
10366. gbvrt75.seq - Other vertebrate sequence entries, part 75.
10367. gbvrt76.seq - Other vertebrate sequence entries, part 76.
10368. gbvrt77.seq - Other vertebrate sequence entries, part 77.
10369. gbvrt78.seq - Other vertebrate sequence entries, part 78.
10370. gbvrt79.seq - Other vertebrate sequence entries, part 79.
10371. gbvrt8.seq - Other vertebrate sequence entries, part 8.
10372. gbvrt80.seq - Other vertebrate sequence entries, part 80.
10373. gbvrt81.seq - Other vertebrate sequence entries, part 81.
10374. gbvrt82.seq - Other vertebrate sequence entries, part 82.
10375. gbvrt83.seq - Other vertebrate sequence entries, part 83.
10376. gbvrt84.seq - Other vertebrate sequence entries, part 84.
10377. gbvrt85.seq - Other vertebrate sequence entries, part 85.
10378. gbvrt86.seq - Other vertebrate sequence entries, part 86.
10379. gbvrt87.seq - Other vertebrate sequence entries, part 87.
10380. gbvrt88.seq - Other vertebrate sequence entries, part 88.
10381. gbvrt89.seq - Other vertebrate sequence entries, part 89.
10382. gbvrt9.seq - Other vertebrate sequence entries, part 9.
10383. gbvrt90.seq - Other vertebrate sequence entries, part 90.
10384. gbvrt91.seq - Other vertebrate sequence entries, part 91.
10385. gbvrt92.seq - Other vertebrate sequence entries, part 92.
10386. gbvrt93.seq - Other vertebrate sequence entries, part 93.
10387. gbvrt94.seq - Other vertebrate sequence entries, part 94.
10388. gbvrt95.seq - Other vertebrate sequence entries, part 95.
10389. gbvrt96.seq - Other vertebrate sequence entries, part 96.
10390. gbvrt97.seq - Other vertebrate sequence entries, part 97.
10391. gbvrt98.seq - Other vertebrate sequence entries, part 98.
10392. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 260.0 flatfiles require roughly 5020 GB,
including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 496287178     gbbct1.seq
 494252307     gbbct10.seq
 497985566     gbbct100.seq
 496362812     gbbct1000.se
 499965956     gbbct1001.se
 241784160     gbbct1002.se
 487481885     gbbct1003.se
 499907021     gbbct1004.se
 490920292     gbbct1005.se
 494565727     gbbct1006.se
 307922837     gbbct1007.se
 496864586     gbbct1008.se
 497451348     gbbct1009.se
 498936992     gbbct101.seq
 499705657     gbbct1010.se
 497304323     gbbct1011.se
 489071996     gbbct1012.se
 402245324     gbbct1013.se
 485295587     gbbct1014.se
 497957254     gbbct1015.se
 488962001     gbbct1016.se
 496580925     gbbct1017.se
 278702105     gbbct1018.se
 498287581     gbbct1019.se
 306897259     gbbct102.seq
 496413920     gbbct1020.se
 486315901     gbbct1021.se
 497952546     gbbct1022.se
 490823685     gbbct1023.se
 498864556     gbbct1024.se
 498569119     gbbct1025.se
 497446501     gbbct1026.se
 497992940     gbbct1027.se
 138760526     gbbct1028.se
 494052501     gbbct1029.se
 491474486     gbbct103.seq
 486687699     gbbct1030.se
 499789086     gbbct1031.se
 487141164     gbbct1032.se
 408413372     gbbct1033.se
 488880735     gbbct1034.se
 499347266     gbbct1035.se
 494529449     gbbct1036.se
 491610200     gbbct1037.se
 490721932     gbbct1038.se
  86529018     gbbct1039.se
 494310694     gbbct104.seq
 498567123     gbbct1040.se
 495529311     gbbct1041.se
 489903020     gbbct1042.se
 495913819     gbbct1043.se
 497489030     gbbct1044.se
 103025934     gbbct1045.se
 490096670     gbbct1046.se
 493769967     gbbct1047.se
 498703344     gbbct1048.se
 487853604     gbbct1049.se
 495814844     gbbct105.seq
 442248924     gbbct1050.se
 498316914     gbbct1051.se
 488080043     gbbct1052.se
 496859443     gbbct1053.se
 492354879     gbbct1054.se
 499504210     gbbct1055.se
 497732328     gbbct1056.se
 496412589     gbbct1057.se
 344196866     gbbct1058.se
 493330442     gbbct1059.se
 498718759     gbbct106.seq
 485808258     gbbct1060.se
 489129281     gbbct1061.se
 494731790     gbbct1062.se
 244810971     gbbct1063.se
 498720082     gbbct1064.se
 498375695     gbbct1065.se
 496798838     gbbct1066.se
 488158907     gbbct1067.se
 480710236     gbbct1068.se
  88915438     gbbct1069.se
 499103885     gbbct107.seq
 488813276     gbbct1070.se
 498905763     gbbct1071.se
 496043153     gbbct1072.se
 487953041     gbbct1073.se
 497348333     gbbct1074.se
 459587986     gbbct1075.se
 497065104     gbbct1076.se
 496207830     gbbct1077.se
 497091224     gbbct1078.se
 493317438     gbbct1079.se
 261686739     gbbct108.seq
 225373769     gbbct1080.se
 489889416     gbbct1081.se
 488595894     gbbct1082.se
 492097019     gbbct1083.se
 499016286     gbbct1084.se
 493001251     gbbct1085.se
 497021233     gbbct1086.se
  75341392     gbbct1087.se
 492195634     gbbct1088.se
 495418776     gbbct1089.se
 498131355     gbbct109.seq
 497607552     gbbct1090.se
 488845674     gbbct1091.se
  49634820     gbbct1092.se
 484950746     gbbct1093.se
 493849892     gbbct1094.se
 494652382     gbbct1095.se
 495532726     gbbct1096.se
 494378942     gbbct1097.se
 498130260     gbbct1098.se
 149325507     gbbct1099.se
 488021801     gbbct11.seq
 499519799     gbbct110.seq
 305005116     gbbct1100.se
   6891549     gbbct1101.se
  14165728     gbbct1102.se
  22799278     gbbct1103.se
  44501788     gbbct1104.se
  86616522     gbbct1105.se
 168554519     gbbct1106.se
 499997623     gbbct1107.se
 492552739     gbbct1108.se
 498179051     gbbct1109.se
 498963367     gbbct111.seq
 499251255     gbbct1110.se
 498134778     gbbct1111.se
 499998525     gbbct1112.se
 131049345     gbbct1113.se
 499998971     gbbct1114.se
 492626536     gbbct1115.se
 494514889     gbbct1116.se
 500000181     gbbct1117.se
 208846697     gbbct1118.se
 499998855     gbbct1119.se
 488108619     gbbct112.seq
 290665907     gbbct1120.se
 499999440     gbbct1121.se
  85450285     gbbct1122.se
 499999527     gbbct1123.se
 125443734     gbbct1124.se
 499998544     gbbct1125.se
  43687538     gbbct1126.se
 148196213     gbbct1127.se
 499601204     gbbct1128.se
 496959806     gbbct1129.se
 397950750     gbbct113.seq
 130886279     gbbct1130.se
 497082557     gbbct1131.se
 489911678     gbbct1132.se
 494010738     gbbct1133.se
 497933088     gbbct1134.se
 497254623     gbbct1135.se
 488464410     gbbct1136.se
 305471126     gbbct1137.se
 495496664     gbbct1138.se
 498006029     gbbct1139.se
 498261630     gbbct114.seq
 498179394     gbbct1140.se
 168612728     gbbct1141.se
 472461650     gbbct1142.se
 498353095     gbbct1143.se
 494354834     gbbct1144.se
 496897920     gbbct1145.se
 150527887     gbbct1146.se
 487524356     gbbct1147.se
 490669386     gbbct1148.se
 493112739     gbbct1149.se
 492775885     gbbct115.seq
 322802376     gbbct1150.se
 498499362     gbbct1151.se
 498686725     gbbct1152.se
 496133880     gbbct1153.se
 499010889     gbbct1154.se
  91015538     gbbct1155.se
 496306865     gbbct1156.se
 497542063     gbbct1157.se
 499041476     gbbct1158.se
 243471493     gbbct1159.se
 495523584     gbbct116.seq
 492628077     gbbct1160.se
 496920917     gbbct1161.se
 498726034     gbbct1162.se
 498558295     gbbct1163.se
 105681277     gbbct1164.se
 499379475     gbbct1165.se
 499045569     gbbct1166.se
 496138259     gbbct1167.se
 480917975     gbbct1168.se
  51247899     gbbct1169.se
 300972567     gbbct117.seq
 107895686     gbbct1170.se
 499937592     gbbct1171.se
 499998388     gbbct1172.se
 420981112     gbbct1173.se
 499997337     gbbct1174.se
 499998352     gbbct1175.se
 499999552     gbbct1176.se
 499952650     gbbct1177.se
 495898806     gbbct1178.se
 297551787     gbbct1179.se
 491271704     gbbct118.seq
 496928169     gbbct1180.se
 498809575     gbbct1181.se
 497701955     gbbct1182.se
 497288384     gbbct1183.se
 497076187     gbbct1184.se
 490313192     gbbct1185.se
 147313851     gbbct1186.se
 498338739     gbbct1187.se
 498433841     gbbct1188.se
 495474043     gbbct1189.se
 498541367     gbbct119.seq
 497231916     gbbct1190.se
 122463870     gbbct1191.se
 499023843     gbbct1192.se
 498317346     gbbct1193.se
 497455603     gbbct1194.se
 441278764     gbbct1195.se
 495797802     gbbct1196.se
 499268668     gbbct1197.se
 498072813     gbbct1198.se
 497105749     gbbct1199.se
 497611603     gbbct12.seq
 498012873     gbbct120.seq
 499992029     gbbct1200.se
  16749202     gbbct1201.se
  92795209     gbbct121.seq
 489628699     gbbct122.seq
 499324337     gbbct123.seq
 494929667     gbbct124.seq
 265604294     gbbct125.seq
 499874269     gbbct126.seq
 499262998     gbbct127.seq
 499292951     gbbct128.seq
 491408959     gbbct129.seq
  53797929     gbbct13.seq
  13752576     gbbct130.seq
 493589580     gbbct131.seq
 494743921     gbbct132.seq
 495417049     gbbct133.seq
 491069774     gbbct134.seq
 195549944     gbbct135.seq
 494137417     gbbct136.seq
 492532726     gbbct137.seq
 495041732     gbbct138.seq
 487010439     gbbct139.seq
 491782812     gbbct14.seq
  24639450     gbbct140.seq
 499011110     gbbct141.seq
 494100520     gbbct142.seq
 498830195     gbbct143.seq
 333294047     gbbct144.seq
 490710505     gbbct145.seq
 498618665     gbbct146.seq
 488692906     gbbct147.seq
 494287785     gbbct148.seq
  18986455     gbbct149.seq
 498493275     gbbct15.seq
 495983596     gbbct150.seq
 489371941     gbbct151.seq
 487156770     gbbct152.seq
 496236620     gbbct153.seq
 497104744     gbbct154.seq
 488626990     gbbct155.seq
 425698525     gbbct156.seq
 498289543     gbbct157.seq
 489448480     gbbct158.seq
 499735002     gbbct159.seq
 495092987     gbbct16.seq
 461302583     gbbct160.seq
 495776225     gbbct161.seq
 493829919     gbbct162.seq
 491661553     gbbct163.seq
 498685718     gbbct164.seq
 499806129     gbbct165.seq
 147979379     gbbct166.seq
 497197592     gbbct167.seq
 494838837     gbbct168.seq
 493252162     gbbct169.seq
 494426713     gbbct17.seq
 494938087     gbbct170.seq
 404787642     gbbct171.seq
 489367719     gbbct172.seq
 490447415     gbbct173.seq
 488202438     gbbct174.seq
 496590169     gbbct175.seq
 497571141     gbbct176.seq
 443840966     gbbct177.seq
 497283776     gbbct178.seq
 494967884     gbbct179.seq
 128500945     gbbct18.seq
 487708276     gbbct180.seq
 498243616     gbbct181.seq
 495949065     gbbct182.seq
 498199776     gbbct183.seq
 192990964     gbbct184.seq
 494757634     gbbct185.seq
 491514316     gbbct186.seq
 499168986     gbbct187.seq
 486267941     gbbct188.seq
 497456534     gbbct189.seq
 494541260     gbbct19.seq
 491062217     gbbct190.seq
 495175628     gbbct191.seq
 498913494     gbbct192.seq
  23086746     gbbct193.seq
 493968442     gbbct194.seq
 480244396     gbbct195.seq
 494911427     gbbct196.seq
 495985799     gbbct197.seq
 204649716     gbbct198.seq
 493675946     gbbct199.seq
 496211451     gbbct2.seq
 496123444     gbbct20.seq
 491173651     gbbct200.seq
 499375502     gbbct201.seq
 273476043     gbbct202.seq
 495005792     gbbct203.seq
 495932946     gbbct204.seq
 489790171     gbbct205.seq
 303707270     gbbct206.seq
 499227728     gbbct207.seq
 499997437     gbbct208.seq
 495765211     gbbct209.seq
 490072401     gbbct21.seq
 496021892     gbbct210.seq
  78326746     gbbct211.seq
 498037177     gbbct212.seq
 499411133     gbbct213.seq
 492695635     gbbct214.seq
 498018382     gbbct215.seq
 490659501     gbbct216.seq
 223651027     gbbct217.seq
 498767453     gbbct218.seq
 497238762     gbbct219.seq
 499143021     gbbct22.seq
 494572644     gbbct220.seq
 497330404     gbbct221.seq
 275862677     gbbct222.seq
 495095493     gbbct223.seq
 495971852     gbbct224.seq
 496465144     gbbct225.seq
 499477316     gbbct226.seq
 258503230     gbbct227.seq
 499818455     gbbct228.seq
 497426013     gbbct229.seq
 147824787     gbbct23.seq
 497029407     gbbct230.seq
 497534555     gbbct231.seq
 440229874     gbbct232.seq
 499335074     gbbct233.seq
 499195099     gbbct234.seq
 491642061     gbbct235.seq
 492380565     gbbct236.seq
 499897679     gbbct237.seq
 493329011     gbbct238.seq
 411207392     gbbct239.seq
 492482066     gbbct24.seq
 497109684     gbbct240.seq
 493797293     gbbct241.seq
 496714946     gbbct242.seq
 378276833     gbbct243.seq
 484833418     gbbct244.seq
 495933660     gbbct245.seq
 496841580     gbbct246.seq
 499799747     gbbct247.seq
 241101627     gbbct248.seq
 494770130     gbbct249.seq
 490124704     gbbct25.seq
 490933060     gbbct250.seq
 491178266     gbbct251.seq
 207236540     gbbct252.seq
 493892730     gbbct253.seq
 496233174     gbbct254.seq
 499658653     gbbct255.seq
 495112805     gbbct256.seq
 184138816     gbbct257.seq
 494063188     gbbct258.seq
 488281809     gbbct259.seq
 498215012     gbbct26.seq
 489824741     gbbct260.seq
 488530738     gbbct261.seq
 157432032     gbbct262.seq
 483160900     gbbct263.seq
 493212976     gbbct264.seq
 489922760     gbbct265.seq
 495741984     gbbct266.seq
  65305285     gbbct267.seq
 492193971     gbbct268.seq
 487559489     gbbct269.seq
 492065538     gbbct27.seq
 492444592     gbbct270.seq
 467376654     gbbct271.seq
 498159122     gbbct272.seq
 490705586     gbbct273.seq
 496101837     gbbct274.seq
 494853089     gbbct275.seq
 496630896     gbbct276.seq
 145951585     gbbct277.seq
 492031399     gbbct278.seq
 498469135     gbbct279.seq
 484403607     gbbct28.seq
 484960266     gbbct280.seq
 462509816     gbbct281.seq
 497610739     gbbct282.seq
 496248013     gbbct283.seq
 496576110     gbbct284.seq
 492200324     gbbct285.seq
  79411871     gbbct286.seq
 496061758     gbbct287.seq
 492890776     gbbct288.seq
 496405538     gbbct289.seq
  60915698     gbbct29.seq
 492437035     gbbct290.seq
 491980814     gbbct291.seq
 499779547     gbbct292.seq
 493162881     gbbct293.seq
 301876942     gbbct294.seq
 499672832     gbbct295.seq
 493482197     gbbct296.seq
 491572664     gbbct297.seq
 414251019     gbbct298.seq
 497188760     gbbct299.seq
 306982367     gbbct3.seq
 490496973     gbbct30.seq
 496648115     gbbct300.seq
 496913431     gbbct301.seq
 468997161     gbbct302.seq
 495339097     gbbct303.seq
 499422165     gbbct304.seq
 499643473     gbbct305.seq
 499684846     gbbct306.seq
  41768798     gbbct307.seq
 496934774     gbbct308.seq
 495160495     gbbct309.seq
 493807118     gbbct31.seq
 499828705     gbbct310.seq
 494345275     gbbct311.seq
  96357788     gbbct312.seq
 498905811     gbbct313.seq
 490840163     gbbct314.seq
 495726928     gbbct315.seq
 488834247     gbbct316.seq
 489385997     gbbct317.seq
 489621383     gbbct318.seq
 394578864     gbbct319.seq
 480651846     gbbct32.seq
 492233252     gbbct320.seq
 490787305     gbbct321.seq
 493826897     gbbct322.seq
 499495355     gbbct323.seq
 419419915     gbbct324.seq
 493089434     gbbct325.seq
 494047950     gbbct326.seq
 489966771     gbbct327.seq
 493459402     gbbct328.seq
 449948014     gbbct329.seq
 497456823     gbbct33.seq
 498703691     gbbct330.seq
 497743974     gbbct331.seq
 489574438     gbbct332.seq
 495982538     gbbct333.seq
 498393188     gbbct334.seq
  23849985     gbbct335.seq
 498785988     gbbct336.seq
 497116267     gbbct337.seq
 497441863     gbbct338.seq
 497888957     gbbct339.seq
 156444864     gbbct34.seq
 404226261     gbbct340.seq
 491217162     gbbct341.seq
 490815943     gbbct342.seq
 491231601     gbbct343.seq
 495603079     gbbct344.seq
 499559349     gbbct345.seq
 172565099     gbbct346.seq
 495566496     gbbct347.seq
 494438770     gbbct348.seq
 495091042     gbbct349.seq
 489377681     gbbct35.seq
 498263560     gbbct350.seq
 263588689     gbbct351.seq
 498444518     gbbct352.seq
 488346394     gbbct353.seq
 490826009     gbbct354.seq
 490002121     gbbct355.seq
 498584108     gbbct356.seq
  34513818     gbbct357.seq
 494686646     gbbct358.seq
 492315257     gbbct359.seq
 493023040     gbbct36.seq
 497177727     gbbct360.seq
 498199987     gbbct361.seq
 496450834     gbbct362.seq
 499463057     gbbct363.seq
 496402256     gbbct364.seq
 380192201     gbbct365.seq
 497476174     gbbct366.seq
 497184589     gbbct367.seq
 490324957     gbbct368.seq
 499750408     gbbct369.seq
 491085315     gbbct37.seq
 494815524     gbbct370.seq
 494368852     gbbct371.seq
 296175547     gbbct372.seq
 499934220     gbbct373.seq
 494918479     gbbct374.seq
 499105302     gbbct375.seq
 488455811     gbbct376.seq
 497844006     gbbct377.seq
  63763834     gbbct378.seq
 499660347     gbbct379.seq
 499929213     gbbct38.seq
 492399147     gbbct380.seq
 494459355     gbbct381.seq
 499024271     gbbct382.seq
 499090333     gbbct383.seq
 499519156     gbbct384.seq
 498494475     gbbct385.seq
  44978842     gbbct386.seq
 496486900     gbbct387.seq
 499584365     gbbct388.seq
 493277883     gbbct389.seq
 458147042     gbbct39.seq
 498905688     gbbct390.seq
 239477237     gbbct391.seq
 498729336     gbbct392.seq
 490199199     gbbct393.seq
 491454197     gbbct394.seq
 499237446     gbbct395.seq
 169554493     gbbct396.seq
 497759841     gbbct397.seq
 496982014     gbbct398.seq
 492202185     gbbct399.seq
 394766098     gbbct4.seq
 486859082     gbbct40.seq
 496555435     gbbct400.seq
 497898531     gbbct401.seq
 488975488     gbbct402.seq
 499658208     gbbct403.seq
 252733250     gbbct404.seq
 497028059     gbbct405.seq
 495273099     gbbct406.seq
 487707838     gbbct407.seq
 490129774     gbbct408.seq
 492973420     gbbct409.seq
 493062757     gbbct41.seq
 497851540     gbbct410.seq
 488688528     gbbct411.seq
  55716177     gbbct412.seq
 489741626     gbbct413.seq
 489855464     gbbct414.seq
 487046945     gbbct415.seq
 487809563     gbbct416.seq
 489424912     gbbct417.seq
 285123482     gbbct418.seq
 496006336     gbbct419.seq
 497593190     gbbct42.seq
 499738879     gbbct420.seq
 498949655     gbbct421.seq
 499696916     gbbct422.seq
 499675367     gbbct423.seq
 493594960     gbbct424.seq
 281241371     gbbct425.seq
 492474819     gbbct426.seq
 493348301     gbbct427.seq
 499433263     gbbct428.seq
 499804088     gbbct429.seq
 497599246     gbbct43.seq
 497607962     gbbct430.seq
 493329202     gbbct431.seq
 489095235     gbbct432.seq
 218287198     gbbct433.seq
 497624057     gbbct434.seq
 499092545     gbbct435.seq
 495168521     gbbct436.seq
 498412076     gbbct437.seq
 494851599     gbbct438.seq
  97103164     gbbct439.seq
 150691069     gbbct44.seq
 498860397     gbbct440.seq
 497205565     gbbct441.seq
 499844044     gbbct442.seq
 496022913     gbbct443.seq
 472540173     gbbct444.seq
 498899686     gbbct445.seq
 494286487     gbbct446.seq
 496090339     gbbct447.seq
 496388697     gbbct448.seq
 308316949     gbbct449.seq
 499427339     gbbct45.seq
 495477408     gbbct450.seq
 492644393     gbbct451.seq
 497637802     gbbct452.seq
 486496075     gbbct453.seq
 411107174     gbbct454.seq
 492341559     gbbct455.seq
 496407771     gbbct456.seq
 499836431     gbbct457.seq
 499613578     gbbct458.seq
 177084086     gbbct459.seq
 489001679     gbbct46.seq
 494159514     gbbct460.seq
 494447782     gbbct461.seq
 493701383     gbbct462.seq
 499969675     gbbct463.seq
  27014882     gbbct464.seq
 493433738     gbbct465.seq
 492700729     gbbct466.seq
 497334211     gbbct467.seq
 497146734     gbbct468.seq
 497594418     gbbct469.seq
 493930026     gbbct47.seq
 328581942     gbbct470.seq
 498313678     gbbct471.seq
 498681410     gbbct472.seq
 499281238     gbbct473.seq
 489146170     gbbct474.seq
 496938156     gbbct475.seq
 497700245     gbbct476.seq
 326142728     gbbct477.seq
 497824575     gbbct478.seq
 492957955     gbbct479.seq
 422791690     gbbct48.seq
 499833240     gbbct480.seq
 493523696     gbbct481.seq
  86825136     gbbct482.seq
 485664252     gbbct483.seq
 492762413     gbbct484.seq
 493976820     gbbct485.seq
 498624920     gbbct486.seq
 495051074     gbbct487.seq
 487461729     gbbct488.seq
 498156344     gbbct489.seq
 487126791     gbbct49.seq
 496028769     gbbct490.seq
 491749735     gbbct491.seq
 498276907     gbbct492.seq
 242945388     gbbct493.seq
 488399361     gbbct494.seq
 497609771     gbbct495.seq
 493602123     gbbct496.seq
 499477169     gbbct497.seq
 490837891     gbbct498.seq
 457708752     gbbct499.seq
 440881567     gbbct5.seq
 497002990     gbbct50.seq
 494383928     gbbct500.seq
 493402330     gbbct501.seq
 495774412     gbbct502.seq
 498340162     gbbct503.seq
 225257265     gbbct504.seq
 499854501     gbbct505.seq
 493894094     gbbct506.seq
 494717321     gbbct507.seq
 494636787     gbbct508.seq
  66755510     gbbct509.seq
 494993905     gbbct51.seq
 499644992     gbbct510.seq
 495494012     gbbct511.seq
 496185227     gbbct512.seq
 498591418     gbbct513.seq
 207264163     gbbct514.seq
 490781428     gbbct515.seq
 491825514     gbbct516.seq
 497965134     gbbct517.seq
 493465756     gbbct518.seq
 495756445     gbbct519.seq
 496658325     gbbct52.seq
 489031514     gbbct520.seq
 324241305     gbbct521.seq
 496815387     gbbct522.seq
 495894844     gbbct523.seq
 496919257     gbbct524.seq
 498915366     gbbct525.seq
 490956192     gbbct526.seq
 487289412     gbbct527.seq
 499232993     gbbct528.seq
  20072397     gbbct529.seq
 355502793     gbbct53.seq
 499107724     gbbct530.seq
 498327939     gbbct531.seq
 487513843     gbbct532.seq
 499771125     gbbct533.seq
 180056506     gbbct534.seq
 495729672     gbbct535.seq
 499956642     gbbct536.seq
 491684752     gbbct537.seq
 499940634     gbbct538.seq
 178743780     gbbct539.seq
 493214445     gbbct54.seq
 489613825     gbbct540.seq
 496013526     gbbct541.seq
 497792053     gbbct542.seq
 492186264     gbbct543.seq
 493342388     gbbct544.seq
 497350442     gbbct545.seq
 489375163     gbbct546.seq
 200235524     gbbct547.seq
 498069933     gbbct548.seq
 491392893     gbbct549.seq
 489295405     gbbct55.seq
 493157818     gbbct550.seq
 490957679     gbbct551.seq
 495408257     gbbct552.seq
 487407958     gbbct553.seq
  79579587     gbbct554.seq
 498600338     gbbct555.seq
 499966991     gbbct556.seq
 498301065     gbbct557.seq
 489056192     gbbct558.seq
 497247109     gbbct559.seq
 492859989     gbbct56.seq
 182974922     gbbct560.seq
 499605229     gbbct561.seq
 498413363     gbbct562.seq
 494321141     gbbct563.seq
 488737962     gbbct564.seq
 493654397     gbbct565.seq
 492441672     gbbct566.seq
 227319570     gbbct567.seq
 489360452     gbbct568.seq
 496232132     gbbct569.seq
 496347182     gbbct57.seq
 499644047     gbbct570.seq
 499053621     gbbct571.seq
 347744399     gbbct572.seq
 497665012     gbbct573.seq
 498846279     gbbct574.seq
 496910394     gbbct575.seq
 497597366     gbbct576.seq
 490846807     gbbct577.seq
 441215744     gbbct578.seq
 499933080     gbbct579.seq
 497764657     gbbct58.seq
 492754222     gbbct580.seq
 490407083     gbbct581.seq
 497293274     gbbct582.seq
 496382627     gbbct583.seq
  65191689     gbbct584.seq
 492186833     gbbct585.seq
 494015530     gbbct586.seq
 496612101     gbbct587.seq
 499928513     gbbct588.seq
 499346460     gbbct589.seq
 499974435     gbbct59.seq
  84038456     gbbct590.seq
 498299546     gbbct591.seq
 497665812     gbbct592.seq
 495789156     gbbct593.seq
 498920659     gbbct594.seq
 490859835     gbbct595.seq
 497455540     gbbct596.seq
 291276486     gbbct597.seq
 499291931     gbbct598.seq
 496184725     gbbct599.seq
 102349966     gbbct6.seq
 251724694     gbbct60.seq
 497684555     gbbct600.seq
 494237521     gbbct601.seq
 493055862     gbbct602.seq
 370271790     gbbct603.seq
 496709072     gbbct604.seq
 497463400     gbbct605.seq
 497716036     gbbct606.seq
 499783508     gbbct607.seq
 498704319     gbbct608.seq
 493521081     gbbct609.seq
  21423513     gbbct61.seq
 412974908     gbbct610.seq
 498977008     gbbct611.seq
 489139156     gbbct612.seq
 498929930     gbbct613.seq
 496323535     gbbct614.seq
 493188592     gbbct615.seq
 331826220     gbbct616.seq
 495637102     gbbct617.seq
 497904827     gbbct618.seq
 497941545     gbbct619.seq
  38673495     gbbct62.seq
 496364847     gbbct620.seq
 299920780     gbbct621.seq
 494009530     gbbct622.seq
 494634341     gbbct623.seq
 493680575     gbbct624.seq
 495249687     gbbct625.seq
 336973710     gbbct626.seq
 490780930     gbbct627.seq
 491958315     gbbct628.seq
 493755472     gbbct629.seq
 499581734     gbbct63.seq
 496675611     gbbct630.seq
   8691501     gbbct631.seq
 489363579     gbbct632.seq
 498539049     gbbct633.seq
 495886964     gbbct634.seq
 498572123     gbbct635.seq
 118171825     gbbct636.seq
 498744177     gbbct637.seq
 496347095     gbbct638.seq
 497967870     gbbct639.seq
 484470178     gbbct64.seq
 499466505     gbbct640.seq
 151864087     gbbct641.seq
 499234904     gbbct642.seq
 497360436     gbbct643.seq
 498571346     gbbct644.seq
 494200871     gbbct645.seq
 498167631     gbbct646.seq
 115652733     gbbct647.seq
 499500345     gbbct648.seq
 499024240     gbbct649.seq
 495470178     gbbct65.seq
 498504839     gbbct650.seq
 492505677     gbbct651.seq
 435599661     gbbct652.seq
 496593582     gbbct653.seq
 489654969     gbbct654.seq
 495682691     gbbct655.seq
 496837809     gbbct656.seq
 499832379     gbbct657.seq
 257450135     gbbct658.seq
 489897285     gbbct659.seq
 480119351     gbbct66.seq
 487794703     gbbct660.seq
 490412388     gbbct661.seq
 498964778     gbbct662.seq
  86369099     gbbct663.seq
 498236694     gbbct664.seq
 499932377     gbbct665.seq
 495968096     gbbct666.seq
 498905950     gbbct667.seq
 490031347     gbbct668.seq
  53951819     gbbct669.seq
 499782379     gbbct67.seq
 492741697     gbbct670.seq
 494948998     gbbct671.seq
 496173329     gbbct672.seq
 497056597     gbbct673.seq
 492511718     gbbct674.seq
 190304579     gbbct675.seq
 486682807     gbbct676.seq
 499351047     gbbct677.seq
 488816854     gbbct678.seq
 495179308     gbbct679.seq
 499379755     gbbct68.seq
  86022844     gbbct680.seq
 492651932     gbbct681.seq
 490980118     gbbct682.seq
 489246739     gbbct683.seq
 499239895     gbbct684.seq
 373665763     gbbct685.seq
 484560036     gbbct686.seq
 496483779     gbbct687.seq
 499170141     gbbct688.seq
 499849805     gbbct689.seq
 496319170     gbbct69.seq
 496930689     gbbct690.seq
  77480547     gbbct691.seq
 490730264     gbbct692.seq
 484804752     gbbct693.seq
 495815674     gbbct694.seq
 494968964     gbbct695.seq
 499117399     gbbct696.seq
 470832214     gbbct697.seq
 498585011     gbbct698.seq
 490185585     gbbct699.seq
 282572292     gbbct7.seq
 493547495     gbbct70.seq
 496766470     gbbct700.seq
 493633651     gbbct701.seq
 448568712     gbbct702.seq
 495687276     gbbct703.seq
 499162833     gbbct704.seq
 497361325     gbbct705.seq
 485427063     gbbct706.seq
 496502443     gbbct707.seq
 494013928     gbbct708.seq
 498751351     gbbct709.seq
 496583296     gbbct71.seq
 134600985     gbbct710.seq
 489500728     gbbct711.seq
 499402390     gbbct712.seq
 491721551     gbbct713.seq
 491499364     gbbct714.seq
 497510258     gbbct715.seq
 149306247     gbbct716.seq
 489374489     gbbct717.seq
 497451108     gbbct718.seq
 496794678     gbbct719.seq
 328859600     gbbct72.seq
 493494360     gbbct720.seq
 384421334     gbbct721.seq
 497700125     gbbct722.seq
 488532823     gbbct723.seq
 492470395     gbbct724.seq
 499420581     gbbct725.seq
 490827314     gbbct726.seq
 494681775     gbbct727.seq
 403377416     gbbct728.seq
 499130334     gbbct729.seq
 496359235     gbbct73.seq
 496018987     gbbct730.seq
 497460894     gbbct731.seq
 498976892     gbbct732.seq
 200306245     gbbct733.seq
 495669263     gbbct734.seq
 496736764     gbbct735.seq
 499472704     gbbct736.seq
 496906539     gbbct737.seq
 265602948     gbbct738.seq
 489239513     gbbct739.seq
 491310628     gbbct74.seq
 495250207     gbbct740.seq
 496364572     gbbct741.seq
 498966707     gbbct742.seq
 498472004     gbbct743.seq
 491679988     gbbct744.seq
 210465085     gbbct745.seq
 497477929     gbbct746.seq
 499954401     gbbct747.seq
 498848686     gbbct748.seq
 494646909     gbbct749.seq
 499897138     gbbct75.seq
 488220514     gbbct750.seq
 489101643     gbbct751.seq
 496928116     gbbct752.seq
 499598277     gbbct753.seq
 498953975     gbbct754.seq
 495530526     gbbct755.seq
 264656125     gbbct756.seq
 498403720     gbbct757.seq
 485253711     gbbct758.seq
 499082940     gbbct759.seq
 492176878     gbbct76.seq
 499996563     gbbct760.seq
 258554892     gbbct761.seq
 493217012     gbbct762.seq
 499473395     gbbct763.seq
 497057366     gbbct764.seq
 498074131     gbbct765.seq
 492582914     gbbct766.seq
 485827167     gbbct767.seq
  61156121     gbbct768.seq
 497138841     gbbct769.seq
 495817498     gbbct77.seq
 491235808     gbbct770.seq
 498455829     gbbct771.seq
 489185447     gbbct772.seq
 492644404     gbbct773.seq
 498753393     gbbct774.seq
 488711749     gbbct775.seq
 131231612     gbbct776.seq
 492675721     gbbct777.seq
 496014682     gbbct778.seq
 496634437     gbbct779.seq
 356563135     gbbct78.seq
 499730148     gbbct780.seq
 499290021     gbbct781.seq
 498135561     gbbct782.seq
   6896993     gbbct783.seq
 493723515     gbbct784.seq
 489427729     gbbct785.seq
 493543573     gbbct786.seq
 499904919     gbbct787.seq
 492366323     gbbct788.seq
 147332336     gbbct789.seq
 499974953     gbbct79.seq
 493624806     gbbct790.seq
 499752905     gbbct791.seq
 499573689     gbbct792.seq
 497909072     gbbct793.seq
 492955232     gbbct794.seq
 372003106     gbbct795.seq
 494266921     gbbct796.seq
 499880264     gbbct797.seq
 496540368     gbbct798.seq
 488887473     gbbct799.seq
 493067249     gbbct8.seq
 492293309     gbbct80.seq
 498831883     gbbct800.seq
 494409623     gbbct801.seq
 251776526     gbbct802.seq
 497781045     gbbct803.seq
 488676605     gbbct804.seq
 498176921     gbbct805.seq
 498718872     gbbct806.seq
 165471252     gbbct807.seq
 475198041     gbbct808.seq
 489749636     gbbct809.seq
 489450351     gbbct81.seq
 499221798     gbbct810.seq
 498397855     gbbct811.seq
 113736284     gbbct812.seq
 495181148     gbbct813.seq
 499983744     gbbct814.seq
 499737988     gbbct815.seq
 494858412     gbbct816.seq
 144089808     gbbct817.seq
 491812002     gbbct818.seq
 499996546     gbbct819.seq
 497371935     gbbct82.seq
 497819843     gbbct820.seq
 494535725     gbbct821.seq
 492708370     gbbct822.seq
 168444592     gbbct823.seq
 488652334     gbbct824.seq
 488114212     gbbct825.seq
 498658746     gbbct826.seq
 496790303     gbbct827.seq
 473913324     gbbct828.seq
 497613273     gbbct829.seq
 499930544     gbbct83.seq
 489472553     gbbct830.seq
 490799102     gbbct831.seq
 499850096     gbbct832.seq
 493503004     gbbct833.seq
 496618856     gbbct834.seq
   9377846     gbbct835.seq
 499345558     gbbct836.seq
 499169539     gbbct837.seq
 478043660     gbbct838.seq
 497899771     gbbct839.seq
 495180718     gbbct84.seq
 483516074     gbbct840.seq
 472253235     gbbct841.seq
 480467059     gbbct842.seq
 484659763     gbbct843.seq
 485732304     gbbct844.seq
 488085463     gbbct845.seq
 345073306     gbbct846.seq
 485348019     gbbct847.seq
 482138135     gbbct848.seq
 497085295     gbbct849.seq
 112142549     gbbct85.seq
 484782978     gbbct850.seq
 489619570     gbbct851.seq
  44519635     gbbct852.seq
 491997638     gbbct853.seq
 486894684     gbbct854.seq
 481252476     gbbct855.seq
 495800065     gbbct856.seq
 484019833     gbbct857.seq
  77685133     gbbct858.seq
 486231313     gbbct859.seq
 498097197     gbbct86.seq
 496223081     gbbct860.seq
 491580839     gbbct861.seq
 491405829     gbbct862.seq
  82425700     gbbct863.seq
 499290430     gbbct864.seq
 496846111     gbbct865.seq
 490674568     gbbct866.seq
 481905885     gbbct867.seq
  99618161     gbbct868.seq
 493058565     gbbct869.seq
 499071341     gbbct87.seq
 491515521     gbbct870.seq
 489464345     gbbct871.seq
 495754091     gbbct872.seq
 498217145     gbbct873.seq
 365656348     gbbct874.seq
 491116523     gbbct875.seq
 482359949     gbbct876.seq
 488081602     gbbct877.seq
 493545463     gbbct878.seq
 497142631     gbbct879.seq
 496564072     gbbct88.seq
 179858777     gbbct880.seq
 487663562     gbbct881.seq
 495543766     gbbct882.seq
 498277753     gbbct883.seq
 493023124     gbbct884.seq
 392707600     gbbct885.seq
 488631829     gbbct886.seq
 496429393     gbbct887.seq
 497402677     gbbct888.seq
 494685238     gbbct889.seq
 497568359     gbbct89.seq
 496880322     gbbct890.seq
 117662656     gbbct891.seq
 493018997     gbbct892.seq
 496817458     gbbct893.seq
 493468147     gbbct894.seq
 491334180     gbbct895.seq
 480233722     gbbct896.seq
 175201164     gbbct897.seq
 497451646     gbbct898.seq
 498955346     gbbct899.seq
 493342275     gbbct9.seq
 499752716     gbbct90.seq
 497327305     gbbct900.seq
 491770543     gbbct901.seq
  66799543     gbbct902.seq
 489461438     gbbct903.seq
 494810266     gbbct904.seq
 494580291     gbbct905.seq
 492413084     gbbct906.seq
 106734177     gbbct907.seq
 497427384     gbbct908.seq
 490667284     gbbct909.seq
 490382403     gbbct91.seq
 499855884     gbbct910.seq
 496890016     gbbct911.seq
 493067467     gbbct912.seq
  16855374     gbbct913.seq
 483835772     gbbct914.seq
 499918812     gbbct915.seq
 496491202     gbbct916.seq
 489675933     gbbct917.seq
 492129996     gbbct918.seq
 490226088     gbbct919.seq
 257412316     gbbct92.seq
 159226279     gbbct920.seq
 480793665     gbbct921.seq
 494983594     gbbct922.seq
 485761111     gbbct923.seq
 496556611     gbbct924.seq
 494932487     gbbct925.seq
 389974863     gbbct926.seq
 489154742     gbbct927.seq
 487544278     gbbct928.seq
 495478103     gbbct929.seq
 499973085     gbbct93.seq
 499621470     gbbct930.seq
 490914707     gbbct931.seq
 171976605     gbbct932.seq
 496624355     gbbct933.seq
 498116856     gbbct934.seq
 491209216     gbbct935.seq
 498877765     gbbct936.seq
  49427303     gbbct937.seq
 497824019     gbbct938.seq
 498787105     gbbct939.seq
 495194777     gbbct94.seq
 498532955     gbbct940.seq
 495177466     gbbct941.seq
  24930260     gbbct942.seq
 497808297     gbbct943.seq
 498867072     gbbct944.seq
 497996169     gbbct945.seq
 495650587     gbbct946.seq
 307797559     gbbct947.seq
 490110312     gbbct948.seq
 496368345     gbbct949.seq
 486287664     gbbct95.seq
 488326747     gbbct950.seq
 493611670     gbbct951.seq
 494466968     gbbct952.seq
 496923040     gbbct953.seq
 498291750     gbbct954.seq
 197946855     gbbct955.seq
 497030883     gbbct956.seq
 488530172     gbbct957.seq
 494348783     gbbct958.seq
 489732336     gbbct959.seq
 493211142     gbbct96.seq
 491443011     gbbct960.seq
 475734747     gbbct961.seq
 499429504     gbbct962.seq
 495377414     gbbct963.seq
 489344690     gbbct964.seq
 497572474     gbbct965.seq
 496020298     gbbct966.seq
 498682158     gbbct967.seq
 216798166     gbbct968.seq
 491020643     gbbct969.seq
 464468094     gbbct97.seq
 499377837     gbbct970.seq
 493967837     gbbct971.seq
 495491566     gbbct972.seq
 494509945     gbbct973.seq
 498928512     gbbct974.seq
 154447950     gbbct975.seq
 496733429     gbbct976.seq
 498650266     gbbct977.seq
 498957817     gbbct978.seq
 498914658     gbbct979.seq
 490513463     gbbct98.seq
 498072867     gbbct980.seq
 116096552     gbbct981.seq
 497234214     gbbct982.seq
 488987602     gbbct983.seq
 499869557     gbbct984.seq
 493016900     gbbct985.seq
 181046802     gbbct986.seq
 491765620     gbbct987.seq
 495672444     gbbct988.seq
 495410596     gbbct989.seq
 489868629     gbbct99.seq
 492049196     gbbct990.seq
 443120872     gbbct991.seq
 498579030     gbbct992.seq
 499594457     gbbct993.seq
 493899108     gbbct994.seq
 496038146     gbbct995.seq
 495045229     gbbct996.seq
  76329548     gbbct997.seq
 497124987     gbbct998.seq
 497212639     gbbct999.seq
   1768401     gbchg.txt
 499771713     gbcon1.seq
 499001844     gbcon10.seq
 499998115     gbcon100.seq
 499998405     gbcon101.seq
 266690984     gbcon102.seq
 499999116     gbcon103.seq
 499996704     gbcon104.seq
 169667376     gbcon105.seq
 498620364     gbcon106.seq
 497628623     gbcon107.seq
 499999590     gbcon108.seq
 499919512     gbcon109.seq
 499833079     gbcon11.seq
 278371093     gbcon110.seq
 499974307     gbcon111.seq
 499999283     gbcon112.seq
 303110806     gbcon113.seq
 499999395     gbcon114.seq
 499998511     gbcon115.seq
 132524025     gbcon116.seq
 499979980     gbcon117.seq
 499999743     gbcon118.seq
 499875790     gbcon119.seq
 499881160     gbcon12.seq
 221510544     gbcon120.seq
 499999876     gbcon121.seq
 499999395     gbcon122.seq
 222253215     gbcon123.seq
  45836617     gbcon124.seq
 499957250     gbcon125.seq
 499997984     gbcon126.seq
 329164633     gbcon127.seq
 499997617     gbcon128.seq
 499998633     gbcon129.seq
 498755520     gbcon13.seq
 499998997     gbcon130.seq
 196731466     gbcon131.seq
 500000159     gbcon132.seq
 499998737     gbcon133.seq
 242676274     gbcon134.seq
 499998901     gbcon135.seq
 468781384     gbcon136.seq
 499998992     gbcon137.seq
 500000212     gbcon138.seq
 251565376     gbcon139.seq
 498692310     gbcon14.seq
 500000155     gbcon140.seq
 499999225     gbcon141.seq
 414982161     gbcon142.seq
 499999398     gbcon143.seq
 499999246     gbcon144.seq
 181331698     gbcon145.seq
 499998259     gbcon146.seq
 499998534     gbcon147.seq
  23267891     gbcon148.seq
 499895508     gbcon149.seq
 497489461     gbcon15.seq
 499998608     gbcon150.seq
 410183393     gbcon151.seq
 499978406     gbcon152.seq
 499952180     gbcon153.seq
 378810445     gbcon154.seq
 499995981     gbcon155.seq
 499995756     gbcon156.seq
 265279813     gbcon157.seq
 499999292     gbcon158.seq
 499998301     gbcon159.seq
 170068320     gbcon16.seq
  78332616     gbcon160.seq
 499997210     gbcon161.seq
 499583893     gbcon162.seq
 499998422     gbcon163.seq
 147114423     gbcon164.seq
 499889851     gbcon165.seq
 499903152     gbcon166.seq
 499931259     gbcon167.seq
 336542204     gbcon168.seq
 499997937     gbcon169.seq
 499788518     gbcon17.seq
 499999984     gbcon170.seq
 188511440     gbcon171.seq
 499998956     gbcon172.seq
 499998775     gbcon173.seq
 499999277     gbcon174.seq
 274183756     gbcon175.seq
 499999711     gbcon176.seq
 499998667     gbcon177.seq
 499614208     gbcon178.seq
 499997402     gbcon179.seq
 497451497     gbcon18.seq
 146645232     gbcon180.seq
 499999228     gbcon181.seq
 499994813     gbcon182.seq
 133042579     gbcon183.seq
 499996343     gbcon184.seq
 499998857     gbcon185.seq
 499997907     gbcon186.seq
 297643263     gbcon187.seq
 499978865     gbcon188.seq
 499999503     gbcon189.seq
 496868398     gbcon19.seq
 477852492     gbcon190.seq
 500000201     gbcon191.seq
 499998706     gbcon192.seq
 381245142     gbcon193.seq
 499991121     gbcon194.seq
 499996409     gbcon195.seq
 499996232     gbcon196.seq
 139305368     gbcon197.seq
 499998392     gbcon198.seq
 499997881     gbcon199.seq
 499999513     gbcon2.seq
 498779375     gbcon20.seq
  38637152     gbcon200.seq
 499998672     gbcon201.seq
 499998964     gbcon202.seq
 499992879     gbcon203.seq
 499999808     gbcon204.seq
 499966975     gbcon205.seq
 300862133     gbcon206.seq
 499999940     gbcon207.seq
 484916965     gbcon208.seq
 499982897     gbcon209.seq
 499965777     gbcon21.seq
 499944208     gbcon210.seq
 499998274     gbcon211.seq
   4350642     gbcon212.seq
 499999470     gbcon213.seq
 499999019     gbcon214.seq
 499997621     gbcon215.seq
  13869368     gbcon216.seq
 499959905     gbcon217.seq
 499978447     gbcon218.seq
 499998549     gbcon219.seq
 182392487     gbcon22.seq
 276951509     gbcon220.seq
 499913241     gbcon221.seq
 499856376     gbcon222.seq
 499998680     gbcon223.seq
 244496731     gbcon224.seq
 499891387     gbcon225.seq
 499999255     gbcon226.seq
 499686884     gbcon227.seq
 345759611     gbcon228.seq
 499678868     gbcon229.seq
 499998788     gbcon23.seq
 499918621     gbcon230.seq
 499999931     gbcon231.seq
 150052843     gbcon232.seq
 499859365     gbcon233.seq
 499997801     gbcon234.seq
 499993639     gbcon235.seq
 234398663     gbcon236.seq
 499995695     gbcon237.seq
 499991102     gbcon238.seq
 499993687     gbcon239.seq
 499998935     gbcon24.seq
 285765080     gbcon240.seq
 499999534     gbcon25.seq
  84517707     gbcon26.seq
 499999901     gbcon27.seq
 499502844     gbcon28.seq
 498858794     gbcon29.seq
 499992939     gbcon3.seq
 318319660     gbcon30.seq
 499998397     gbcon31.seq
 135784793     gbcon32.seq
 126581434     gbcon33.seq
 499919147     gbcon34.seq
 499998468     gbcon35.seq
  27859502     gbcon36.seq
 499999414     gbcon37.seq
 499998297     gbcon38.seq
 444127134     gbcon39.seq
 106579732     gbcon4.seq
 499999754     gbcon40.seq
 499996186     gbcon41.seq
 499996876     gbcon42.seq
  43314086     gbcon43.seq
 499997302     gbcon44.seq
 499996762     gbcon45.seq
 278164332     gbcon46.seq
 499999359     gbcon47.seq
 499996983     gbcon48.seq
 271759840     gbcon49.seq
 499940282     gbcon5.seq
 499993774     gbcon50.seq
 499997972     gbcon51.seq
 386626626     gbcon52.seq
 499998746     gbcon53.seq
 499998567     gbcon54.seq
 177827600     gbcon55.seq
 499999775     gbcon56.seq
 499998019     gbcon57.seq
 240103744     gbcon58.seq
 499999949     gbcon59.seq
 494454779     gbcon6.seq
 499999067     gbcon60.seq
 337031547     gbcon61.seq
 499998864     gbcon62.seq
 499994811     gbcon63.seq
 299682797     gbcon64.seq
 500000005     gbcon65.seq
 499997545     gbcon66.seq
 261117917     gbcon67.seq
 499995467     gbcon68.seq
 499999403     gbcon69.seq
 494751770     gbcon7.seq
 188551188     gbcon70.seq
 499996910     gbcon71.seq
 499996842     gbcon72.seq
 365761631     gbcon73.seq
 499997884     gbcon74.seq
 499996070     gbcon75.seq
 387269601     gbcon76.seq
 499993101     gbcon77.seq
 473419617     gbcon78.seq
 174082386     gbcon79.seq
 499999724     gbcon8.seq
 499962181     gbcon80.seq
  23946021     gbcon81.seq
 499982982     gbcon82.seq
 204700777     gbcon83.seq
 199582317     gbcon84.seq
 499610606     gbcon85.seq
 499993590     gbcon86.seq
 339126822     gbcon87.seq
 499606703     gbcon88.seq
 495956208     gbcon89.seq
  61944721     gbcon9.seq
 499889199     gbcon90.seq
 204922712     gbcon91.seq
 499993525     gbcon92.seq
 499999357     gbcon93.seq
 499974670     gbcon94.seq
 167049284     gbcon95.seq
 499999630     gbcon96.seq
 499999403     gbcon97.seq
 134059485     gbcon98.seq
 499996152     gbcon99.seq
     16279     gbdel.txt
 499998336     gbenv1.seq
 489563333     gbenv10.seq
 496837533     gbenv11.seq
 495661050     gbenv12.seq
 498193107     gbenv13.seq
 499998018     gbenv14.seq
 415207859     gbenv15.seq
 499998991     gbenv16.seq
 499997691     gbenv17.seq
  53976913     gbenv18.seq
 499999928     gbenv19.seq
 499570082     gbenv2.seq
 499998163     gbenv20.seq
 499999897     gbenv21.seq
 499997884     gbenv22.seq
   5230238     gbenv23.seq
 499999495     gbenv24.seq
 499999831     gbenv25.seq
 190625300     gbenv26.seq
 499987279     gbenv27.seq
 499999423     gbenv28.seq
 499999611     gbenv29.seq
 499622067     gbenv3.seq
  84276301     gbenv30.seq
 499998813     gbenv31.seq
 499999787     gbenv32.seq
 177747378     gbenv33.seq
 499998371     gbenv34.seq
 499999132     gbenv35.seq
 499996755     gbenv36.seq
  46488038     gbenv37.seq
 500000189     gbenv38.seq
 499998209     gbenv39.seq
 495221181     gbenv4.seq
 192975162     gbenv40.seq
 499995152     gbenv41.seq
 499998856     gbenv42.seq
 334992176     gbenv43.seq
 499997709     gbenv44.seq
 500000214     gbenv45.seq
 471575025     gbenv46.seq
 499998597     gbenv47.seq
 499997752     gbenv48.seq
 338689618     gbenv49.seq
 498885723     gbenv5.seq
 500000064     gbenv50.seq
 499999071     gbenv51.seq
 394558028     gbenv52.seq
 499997922     gbenv53.seq
 500000261     gbenv54.seq
 345566361     gbenv55.seq
 499999591     gbenv56.seq
 499998353     gbenv57.seq
 238008735     gbenv58.seq
 499998783     gbenv59.seq
 497050314     gbenv6.seq
 500000239     gbenv60.seq
 391485704     gbenv61.seq
 500000180     gbenv62.seq
 499988942     gbenv63.seq
 499998776     gbenv64.seq
 158405175     gbenv65.seq
 499998477     gbenv66.seq
 500000223     gbenv67.seq
 499998702     gbenv68.seq
 226655873     gbenv69.seq
 490690364     gbenv7.seq
 499999049     gbenv70.seq
 499991665     gbenv71.seq
 315138336     gbenv72.seq
 499999519     gbenv73.seq
 499995038     gbenv74.seq
 490463446     gbenv75.seq
 499996300     gbenv76.seq
 496406195     gbenv77.seq
 499929977     gbenv78.seq
 485709573     gbenv79.seq
 150232843     gbenv8.seq
 496910936     gbenv80.seq
 497684268     gbenv81.seq
 496290245     gbenv82.seq
 499142611     gbenv83.seq
  70467236     gbenv84.seq
 499858755     gbenv85.seq
 497015988     gbenv86.seq
 498288229     gbenv87.seq
 499488014     gbenv88.seq
  60666188     gbenv89.seq
 497122248     gbenv9.seq
 490914790     gbenv90.seq
 499978784     gbenv91.seq
 499888721     gbenv92.seq
 496706876     gbenv93.seq
 499549122     gbenv94.seq
 221729300     gbenv95.seq
 499997165     gbest1.seq
 499998372     gbest10.seq
  35244904     gbest100.seq
 500000144     gbest101.seq
 499999841     gbest102.seq
 499998932     gbest103.seq
 499998888     gbest104.seq
  27238070     gbest105.seq
 499999661     gbest106.seq
 499999925     gbest107.seq
 499996931     gbest108.seq
 499998684     gbest109.seq
 499997203     gbest11.seq
   9968902     gbest110.seq
 499998000     gbest111.seq
 499998611     gbest112.seq
 499999736     gbest113.seq
 499997797     gbest114.seq
  21822201     gbest115.seq
 500000014     gbest116.seq
 499999751     gbest117.seq
 499996861     gbest118.seq
  18205696     gbest119.seq
 475316068     gbest12.seq
 499998016     gbest120.seq
 499998546     gbest121.seq
 499997661     gbest122.seq
  69242600     gbest123.seq
 499997996     gbest124.seq
 499996364     gbest125.seq
 223780385     gbest126.seq
 499997461     gbest127.seq
 499998633     gbest128.seq
 195307357     gbest129.seq
 499999434     gbest13.seq
 499997173     gbest130.seq
 499998792     gbest131.seq
 499995025     gbest132.seq
 499996839     gbest133.seq
  85321549     gbest134.seq
 499999011     gbest135.seq
 500000103     gbest136.seq
 499997620     gbest137.seq
 499997366     gbest138.seq
 104737516     gbest139.seq
 249998944     gbest14.seq
 499998458     gbest140.seq
 499996957     gbest141.seq
 499998279     gbest142.seq
 499998824     gbest143.seq
  29231687     gbest144.seq
 499996862     gbest145.seq
 499996997     gbest146.seq
 499996573     gbest147.seq
 499997714     gbest148.seq
  31783707     gbest149.seq
 499998582     gbest15.seq
 499998615     gbest150.seq
 500000160     gbest151.seq
 499997750     gbest152.seq
 324385313     gbest153.seq
 499997344     gbest154.seq
 499999008     gbest155.seq
 499996792     gbest156.seq
 499998548     gbest157.seq
  26483164     gbest158.seq
 500000031     gbest159.seq
 499998229     gbest16.seq
 499999571     gbest160.seq
 499998740     gbest161.seq
 499999772     gbest162.seq
  11191143     gbest163.seq
 499999112     gbest164.seq
 499999267     gbest165.seq
 499998719     gbest166.seq
 499996395     gbest167.seq
  86443963     gbest168.seq
 500000180     gbest169.seq
 421200379     gbest17.seq
 499996624     gbest170.seq
 499997982     gbest171.seq
 499996832     gbest172.seq
 120388331     gbest173.seq
 499998796     gbest174.seq
 499999076     gbest175.seq
 500000124     gbest176.seq
 500000114     gbest177.seq
  65991139     gbest178.seq
 499999609     gbest179.seq
 499997638     gbest18.seq
 403619645     gbest180.seq
 500000063     gbest181.seq
 500000137     gbest182.seq
 499998032     gbest183.seq
 499996516     gbest184.seq
  42970207     gbest185.seq
 499999115     gbest186.seq
 499999094     gbest187.seq
 499996768     gbest188.seq
 499999160     gbest189.seq
 499998752     gbest19.seq
  42350209     gbest190.seq
 499998700     gbest191.seq
 499999296     gbest192.seq
 499999092     gbest193.seq
 500000084     gbest194.seq
  11591845     gbest195.seq
 499997531     gbest196.seq
 499999408     gbest197.seq
 499997946     gbest198.seq
 499998992     gbest199.seq
 499997601     gbest2.seq
 262834621     gbest20.seq
  28711023     gbest200.seq
 499999911     gbest201.seq
 499998864     gbest202.seq
 500000040     gbest203.seq
 500000241     gbest204.seq
  34252457     gbest205.seq
  13610371     gbest206.seq
 500000052     gbest207.seq
 499997390     gbest208.seq
 328955305     gbest209.seq
 499996504     gbest21.seq
 499997954     gbest210.seq
 500000064     gbest211.seq
 321738245     gbest212.seq
 499999454     gbest213.seq
 499997334     gbest214.seq
 267717003     gbest215.seq
 499997969     gbest216.seq
 499998735     gbest217.seq
 270179763     gbest218.seq
 499999305     gbest219.seq
 499999591     gbest22.seq
 499997889     gbest220.seq
 499996856     gbest221.seq
 499998166     gbest222.seq
  52062769     gbest223.seq
 499999123     gbest224.seq
 499999816     gbest225.seq
 499998079     gbest226.seq
 499993980     gbest227.seq
  47777384     gbest228.seq
 499998310     gbest229.seq
 244567937     gbest23.seq
 499999275     gbest230.seq
 176584566     gbest231.seq
 500000143     gbest232.seq
 499999766     gbest233.seq
 499999388     gbest234.seq
 478350574     gbest235.seq
 499997785     gbest236.seq
 499999603     gbest237.seq
 499997429     gbest238.seq
 462328784     gbest239.seq
 499997973     gbest24.seq
 499999067     gbest240.seq
 499999466     gbest241.seq
 499998544     gbest242.seq
 495996304     gbest243.seq
 499999965     gbest244.seq
 499998071     gbest245.seq
 499999534     gbest246.seq
 499997094     gbest247.seq
  25247852     gbest248.seq
 499999568     gbest249.seq
 500000249     gbest25.seq
 499999137     gbest250.seq
 497314236     gbest251.seq
 499999018     gbest252.seq
 499998363     gbest253.seq
 499998003     gbest254.seq
 499998855     gbest255.seq
  21635727     gbest256.seq
 499998352     gbest257.seq
 499996182     gbest258.seq
 499989855     gbest259.seq
 499999489     gbest26.seq
 499996367     gbest260.seq
  76981960     gbest261.seq
 499998298     gbest262.seq
 499998967     gbest263.seq
 499997490     gbest264.seq
 499999670     gbest265.seq
  15157793     gbest266.seq
 499999864     gbest267.seq
 499999784     gbest268.seq
 499996509     gbest269.seq
 500000205     gbest27.seq
 500000262     gbest270.seq
  61257798     gbest271.seq
 499998700     gbest272.seq
 499999812     gbest273.seq
 499998907     gbest274.seq
 122786557     gbest275.seq
 499996420     gbest276.seq
 499998734     gbest277.seq
 499996180     gbest278.seq
 499998393     gbest279.seq
  49054642     gbest28.seq
  54242421     gbest280.seq
 499997300     gbest281.seq
 499998093     gbest282.seq
 499998043     gbest283.seq
 499998230     gbest284.seq
  57212436     gbest285.seq
 499998277     gbest286.seq
 499997730     gbest287.seq
 499998371     gbest288.seq
 499997837     gbest289.seq
 499998393     gbest29.seq
  12770708     gbest290.seq
 500000262     gbest291.seq
 499999019     gbest292.seq
 499998375     gbest293.seq
 499998091     gbest294.seq
  25149689     gbest295.seq
 499999940     gbest296.seq
 499999169     gbest297.seq
 485630902     gbest298.seq
 499998242     gbest299.seq
 499999737     gbest3.seq
 499999804     gbest30.seq
 499997484     gbest300.seq
 499999992     gbest301.seq
 499999761     gbest302.seq
   5975334     gbest303.seq
 499998338     gbest304.seq
 499998890     gbest305.seq
 499997340     gbest306.seq
 499998284     gbest307.seq
   8756316     gbest308.seq
 499999082     gbest309.seq
 499997642     gbest31.seq
 499999747     gbest310.seq
 499999506     gbest311.seq
 425307183     gbest312.seq
 499999283     gbest313.seq
 499997658     gbest314.seq
 499997613     gbest315.seq
 500000227     gbest316.seq
   1895494     gbest317.seq
 499999089     gbest318.seq
 499996781     gbest319.seq
 487104771     gbest32.seq
 469235953     gbest320.seq
 499999477     gbest321.seq
 499999041     gbest322.seq
 499998051     gbest323.seq
 499998802     gbest324.seq
  40449587     gbest325.seq
 499997688     gbest326.seq
 499998667     gbest327.seq
 499998487     gbest328.seq
 494327711     gbest329.seq
 499996778     gbest33.seq
 499998313     gbest330.seq
 499998062     gbest331.seq
 499998265     gbest332.seq
 499997860     gbest333.seq
  57626621     gbest334.seq
 500000164     gbest335.seq
 500000124     gbest336.seq
 499998630     gbest337.seq
 469754446     gbest338.seq
 499996848     gbest339.seq
 499999303     gbest34.seq
 499997513     gbest340.seq
 499999142     gbest341.seq
 499998193     gbest342.seq
  19805885     gbest343.seq
 499999864     gbest344.seq
 493935721     gbest345.seq
 499998593     gbest346.seq
 499999788     gbest347.seq
 499997106     gbest348.seq
 500000129     gbest349.seq
 500000175     gbest35.seq
   7266296     gbest350.seq
 499999575     gbest351.seq
 499999980     gbest352.seq
 499998807     gbest353.seq
 445592436     gbest354.seq
 499999670     gbest355.seq
 499999568     gbest356.seq
 500000244     gbest357.seq
 385956897     gbest358.seq
 499999372     gbest359.seq
 465924519     gbest36.seq
 500000175     gbest360.seq
 499997997     gbest361.seq
 499998078     gbest362.seq
  23844116     gbest363.seq
 499999898     gbest364.seq
 499997585     gbest365.seq
 500000144     gbest366.seq
 499999050     gbest367.seq
  61911193     gbest368.seq
 166258344     gbest369.seq
 499995198     gbest37.seq
 499999253     gbest370.seq
 499999145     gbest371.seq
 499998201     gbest372.seq
 499997764     gbest373.seq
  88316446     gbest374.seq
 499997671     gbest375.seq
 499999212     gbest376.seq
 499996947     gbest377.seq
 499997464     gbest378.seq
 167276287     gbest379.seq
 499998642     gbest38.seq
 499996810     gbest380.seq
 499997307     gbest381.seq
 499999563     gbest382.seq
 499998315     gbest383.seq
 156079578     gbest384.seq
 499999225     gbest385.seq
 500000080     gbest386.seq
 499996997     gbest387.seq
 496992966     gbest388.seq
 499998244     gbest389.seq
 499999306     gbest39.seq
 499997393     gbest390.seq
 499997868     gbest391.seq
  68565600     gbest392.seq
 499998199     gbest393.seq
 499995697     gbest394.seq
 499997473     gbest395.seq
 499998850     gbest396.seq
  84720974     gbest397.seq
 499996726     gbest398.seq
 499997638     gbest399.seq
 434906986     gbest4.seq
 499998303     gbest40.seq
 499997975     gbest400.seq
 499998294     gbest401.seq
  88035719     gbest402.seq
 499998301     gbest403.seq
 499998566     gbest404.seq
 499999548     gbest405.seq
 499999828     gbest406.seq
  49402563     gbest407.seq
 499999872     gbest408.seq
 499999311     gbest409.seq
 191433257     gbest41.seq
 499999930     gbest410.seq
 499999455     gbest411.seq
  89134158     gbest412.seq
 499997742     gbest413.seq
 499999765     gbest414.seq
 499998949     gbest415.seq
 499993348     gbest416.seq
 124836692     gbest417.seq
 500000243     gbest418.seq
 328529123     gbest419.seq
 499997364     gbest42.seq
 499998493     gbest420.seq
 500000001     gbest421.seq
 499998801     gbest422.seq
 499999215     gbest423.seq
  60918284     gbest424.seq
 499998170     gbest425.seq
 499999153     gbest426.seq
 499999904     gbest427.seq
 410572946     gbest428.seq
 499997260     gbest429.seq
 499997237     gbest43.seq
 499999283     gbest430.seq
 335979604     gbest431.seq
 499998269     gbest432.seq
 500000055     gbest433.seq
 261735757     gbest434.seq
 499999054     gbest435.seq
 499999565     gbest436.seq
 457029835     gbest437.seq
 499997677     gbest438.seq
 499997592     gbest439.seq
 499997245     gbest44.seq
 305631978     gbest440.seq
 499996212     gbest441.seq
 499998106     gbest442.seq
 336207493     gbest443.seq
 499998798     gbest444.seq
 499999337     gbest445.seq
 188594473     gbest446.seq
 499998567     gbest447.seq
 499997513     gbest448.seq
 120724820     gbest449.seq
 499996431     gbest45.seq
 499998216     gbest450.seq
 499998378     gbest451.seq
 144958145     gbest452.seq
 499997877     gbest453.seq
 499999922     gbest454.seq
 146697887     gbest455.seq
 499998626     gbest456.seq
 499997991     gbest457.seq
 499998447     gbest458.seq
 499999775     gbest459.seq
 189558363     gbest46.seq
    801517     gbest460.seq
 499999562     gbest461.seq
 499998109     gbest462.seq
 500000069     gbest463.seq
 499999340     gbest464.seq
  23703713     gbest465.seq
 170019681     gbest466.seq
 499998234     gbest467.seq
 499997948     gbest468.seq
 499998330     gbest469.seq
 499997254     gbest47.seq
 499998840     gbest470.seq
  28589640     gbest471.seq
 499999508     gbest472.seq
 499999012     gbest473.seq
 499997866     gbest474.seq
 500000035     gbest475.seq
  68554444     gbest476.seq
 499998463     gbest477.seq
 499997655     gbest478.seq
 499999203     gbest479.seq
 499997928     gbest48.seq
 499998066     gbest480.seq
  58925223     gbest481.seq
 499999526     gbest482.seq
 499998894     gbest483.seq
 499996608     gbest484.seq
 499998137     gbest485.seq
  36903337     gbest486.seq
 499997365     gbest487.seq
 499998770     gbest488.seq
 499999455     gbest489.seq
 499998755     gbest49.seq
 500000131     gbest490.seq
  74359385     gbest491.seq
 499999195     gbest492.seq
 499999368     gbest493.seq
 499998557     gbest494.seq
 208394234     gbest495.seq
 499996334     gbest496.seq
 499998824     gbest497.seq
 499999004     gbest498.seq
 499997967     gbest499.seq
 500000191     gbest5.seq
 477040413     gbest50.seq
  95452620     gbest500.seq
 499998191     gbest501.seq
 499999459     gbest502.seq
 499996872     gbest503.seq
 499999994     gbest504.seq
  57685887     gbest505.seq
 499995678     gbest506.seq
 499998789     gbest507.seq
 499999954     gbest508.seq
 499998301     gbest509.seq
 499999137     gbest51.seq
 144692159     gbest510.seq
 499998197     gbest511.seq
 499999912     gbest512.seq
 499997275     gbest513.seq
 500000017     gbest514.seq
 144813181     gbest515.seq
 500000059     gbest516.seq
 499998528     gbest517.seq
 500000008     gbest518.seq
 499998914     gbest519.seq
 356399962     gbest52.seq
  20850934     gbest520.seq
 174271459     gbest521.seq
 500000045     gbest522.seq
 499996867     gbest523.seq
  86408028     gbest524.seq
 499998243     gbest525.seq
 499999107     gbest526.seq
  76884582     gbest527.seq
 499999644     gbest528.seq
 499999397     gbest529.seq
 499997197     gbest53.seq
 499998315     gbest530.seq
 499996576     gbest531.seq
 101183181     gbest532.seq
 499998563     gbest533.seq
 499999862     gbest534.seq
 499998938     gbest535.seq
 500000219     gbest536.seq
  11156072     gbest537.seq
 499998167     gbest538.seq
 499998641     gbest539.seq
 499998317     gbest54.seq
 499997727     gbest540.seq
 478138570     gbest541.seq
 499999636     gbest542.seq
 499997579     gbest543.seq
 499999384     gbest544.seq
 418383466     gbest545.seq
 499999742     gbest546.seq
 500000106     gbest547.seq
 499999897     gbest548.seq
 499998376     gbest549.seq
 499998962     gbest55.seq
  83233267     gbest550.seq
 499999613     gbest551.seq
 499998661     gbest552.seq
 499999080     gbest553.seq
 499997383     gbest554.seq
  33029973     gbest555.seq
 499996586     gbest556.seq
 499998720     gbest557.seq
 500000086     gbest558.seq
 499997739     gbest559.seq
 483809258     gbest56.seq
  44574268     gbest560.seq
 499996436     gbest561.seq
 499999784     gbest562.seq
 500000157     gbest563.seq
 499999562     gbest564.seq
  12075913     gbest565.seq
 500000228     gbest566.seq
 499998380     gbest567.seq
 393295288     gbest568.seq
 499999290     gbest569.seq
 500000108     gbest57.seq
 499997222     gbest570.seq
 110561247     gbest571.seq
 499998740     gbest572.seq
 499998382     gbest573.seq
  50523126     gbest574.seq
 499999830     gbest575.seq
 499997898     gbest576.seq
 499999494     gbest577.seq
 499998263     gbest578.seq
 294341514     gbest579.seq
 499997245     gbest58.seq
 499998900     gbest59.seq
 499998385     gbest6.seq
 464412292     gbest60.seq
 499998095     gbest61.seq
 499998609     gbest62.seq
 499996572     gbest63.seq
 499999314     gbest64.seq
   7852741     gbest65.seq
 499996998     gbest66.seq
 499998343     gbest67.seq
 499997357     gbest68.seq
 484334594     gbest69.seq
 499998098     gbest7.seq
 499999502     gbest70.seq
 499998225     gbest71.seq
 499999252     gbest72.seq
 499999251     gbest73.seq
  10307392     gbest74.seq
 123414980     gbest75.seq
 499999298     gbest76.seq
 499998245     gbest77.seq
 499998907     gbest78.seq
 499999038     gbest79.seq
 469427397     gbest8.seq
   6590015     gbest80.seq
 499998041     gbest81.seq
 499995899     gbest82.seq
 499996967     gbest83.seq
 499999190     gbest84.seq
  47161502     gbest85.seq
 500000165     gbest86.seq
 499998080     gbest87.seq
 499999898     gbest88.seq
 499998626     gbest89.seq
 499998435     gbest9.seq
  53869209     gbest90.seq
 499998173     gbest91.seq
 499999170     gbest92.seq
 499996091     gbest93.seq
 472256473     gbest94.seq
 499999347     gbest95.seq
 499999760     gbest96.seq
 499996196     gbest97.seq
 499998634     gbest98.seq
    159223     gbest99.seq
 499997694     gbgss1.seq
  55764222     gbgss10.seq
 499997670     gbgss100.seq
  45810173     gbgss101.seq
 499998092     gbgss102.seq
 499998065     gbgss103.seq
 499997907     gbgss104.seq
 468721568     gbgss105.seq
 499997822     gbgss106.seq
 499999105     gbgss107.seq
 499998583     gbgss108.seq
 499999879     gbgss109.seq
 499998984     gbgss11.seq
  42543282     gbgss110.seq
 499997770     gbgss111.seq
 499999222     gbgss112.seq
 499999399     gbgss113.seq
 319587338     gbgss114.seq
 499997568     gbgss115.seq
 499999109     gbgss116.seq
 499998390     gbgss117.seq
 499998207     gbgss118.seq
 105488645     gbgss119.seq
 499998615     gbgss12.seq
 499997351     gbgss120.seq
 499997815     gbgss121.seq
 499997392     gbgss122.seq
 499998819     gbgss123.seq
   8930221     gbgss124.seq
 499999955     gbgss125.seq
 499998440     gbgss126.seq
 499999539     gbgss127.seq
 451766712     gbgss128.seq
 499998361     gbgss129.seq
 499999319     gbgss13.seq
 499999211     gbgss130.seq
 499997711     gbgss131.seq
 499998622     gbgss132.seq
  29785783     gbgss133.seq
 499997877     gbgss134.seq
 209679641     gbgss135.seq
 500000110     gbgss136.seq
 499999602     gbgss137.seq
 499997969     gbgss138.seq
 500000125     gbgss139.seq
 499999792     gbgss14.seq
  14831686     gbgss140.seq
 499996726     gbgss141.seq
 499997951     gbgss142.seq
 499999528     gbgss143.seq
 499997001     gbgss144.seq
  16786266     gbgss145.seq
 499997786     gbgss146.seq
 499996974     gbgss147.seq
 499999546     gbgss148.seq
 499996547     gbgss149.seq
   4956545     gbgss15.seq
   2045398     gbgss150.seq
 499997382     gbgss151.seq
 499998165     gbgss152.seq
 499998480     gbgss153.seq
 499997367     gbgss154.seq
   6835799     gbgss155.seq
 373333029     gbgss156.seq
 499998282     gbgss157.seq
 500000125     gbgss158.seq
 499998390     gbgss159.seq
 499998710     gbgss16.seq
 456785189     gbgss160.seq
 499999169     gbgss161.seq
 499999754     gbgss162.seq
 499999838     gbgss163.seq
 458300845     gbgss164.seq
 499997998     gbgss165.seq
 499999955     gbgss166.seq
 499998714     gbgss167.seq
 456858700     gbgss168.seq
 499997318     gbgss169.seq
 499999297     gbgss17.seq
 499999217     gbgss170.seq
 500000164     gbgss171.seq
 364172270     gbgss172.seq
 500000047     gbgss173.seq
 500000062     gbgss174.seq
 215814169     gbgss175.seq
 500000172     gbgss176.seq
 499997918     gbgss177.seq
  68464120     gbgss178.seq
 499999079     gbgss179.seq
 499998832     gbgss18.seq
 499999336     gbgss180.seq
 499998518     gbgss181.seq
 499999975     gbgss182.seq
  49671428     gbgss183.seq
 500000207     gbgss184.seq
 499998668     gbgss185.seq
 499998448     gbgss186.seq
 500000134     gbgss187.seq
  41156795     gbgss188.seq
 499999015     gbgss189.seq
 483129236     gbgss19.seq
 499999977     gbgss190.seq
  57632314     gbgss191.seq
 499998791     gbgss192.seq
 499996639     gbgss193.seq
 499997685     gbgss194.seq
 496087090     gbgss195.seq
 499999000     gbgss196.seq
 499998052     gbgss197.seq
 499999020     gbgss198.seq
 499999114     gbgss199.seq
 499997209     gbgss2.seq
 500000074     gbgss20.seq
  56085229     gbgss200.seq
 499998432     gbgss201.seq
 499997989     gbgss202.seq
 499999434     gbgss203.seq
 480823653     gbgss204.seq
 499999696     gbgss205.seq
 499998040     gbgss206.seq
  55217889     gbgss207.seq
 499999671     gbgss208.seq
 499999336     gbgss209.seq
 326435210     gbgss21.seq
 499999851     gbgss210.seq
 483131912     gbgss211.seq
 499997831     gbgss212.seq
 499997658     gbgss213.seq
 499999763     gbgss214.seq
 487715331     gbgss215.seq
 499998512     gbgss216.seq
 499999622     gbgss217.seq
 499998482     gbgss218.seq
 475206737     gbgss219.seq
 499996936     gbgss22.seq
 499999842     gbgss220.seq
 499997798     gbgss221.seq
 499998669     gbgss222.seq
   6150907     gbgss223.seq
 499999723     gbgss224.seq
 499999684     gbgss225.seq
 499998774     gbgss226.seq
 264589422     gbgss227.seq
 499998669     gbgss228.seq
 499997630     gbgss229.seq
 499999113     gbgss23.seq
 499998484     gbgss230.seq
 429774452     gbgss231.seq
 499998680     gbgss232.seq
 499997883     gbgss233.seq
 499999992     gbgss234.seq
 471956638     gbgss235.seq
 499999119     gbgss236.seq
 499999181     gbgss237.seq
 499998472     gbgss238.seq
 419758648     gbgss239.seq
 499998818     gbgss24.seq
 499997909     gbgss240.seq
 499999623     gbgss241.seq
 500000228     gbgss242.seq
 499999473     gbgss243.seq
  18245173     gbgss244.seq
 315572447     gbgss245.seq
 499997744     gbgss246.seq
 499999389     gbgss247.seq
 499998492     gbgss248.seq
 467298948     gbgss249.seq
 499999064     gbgss25.seq
 499998980     gbgss250.seq
 499997328     gbgss251.seq
 500000000     gbgss252.seq
 499997677     gbgss253.seq
  36135099     gbgss254.seq
 499998608     gbgss255.seq
 499999218     gbgss256.seq
 499998113     gbgss257.seq
 499998912     gbgss258.seq
  22042461     gbgss259.seq
  49836535     gbgss26.seq
 499997682     gbgss260.seq
 499997479     gbgss261.seq
 499997847     gbgss262.seq
   1966395     gbgss263.seq
 500000132     gbgss264.seq
 499998920     gbgss265.seq
 499998061     gbgss266.seq
 499491070     gbgss267.seq
 499999723     gbgss268.seq
 499998484     gbgss269.seq
 499996335     gbgss27.seq
 476820220     gbgss270.seq
 499996842     gbgss28.seq
 499997374     gbgss29.seq
 499996818     gbgss3.seq
 499999793     gbgss30.seq
  31342385     gbgss31.seq
 499998298     gbgss32.seq
 499999440     gbgss33.seq
 499997849     gbgss34.seq
 475326860     gbgss35.seq
 499997988     gbgss36.seq
 499998016     gbgss37.seq
 499999097     gbgss38.seq
 499998525     gbgss39.seq
 499999484     gbgss4.seq
  12514272     gbgss40.seq
 499998794     gbgss41.seq
 499997549     gbgss42.seq
 168546271     gbgss43.seq
 499997525     gbgss44.seq
 499997753     gbgss45.seq
 499999140     gbgss46.seq
 486883580     gbgss47.seq
 499998195     gbgss48.seq
 499997714     gbgss49.seq
  41480505     gbgss5.seq
 499997904     gbgss50.seq
 443945964     gbgss51.seq
 499998446     gbgss52.seq
 500000163     gbgss53.seq
 499998431     gbgss54.seq
 421055741     gbgss55.seq
 499998399     gbgss56.seq
 499999998     gbgss57.seq
 500000139     gbgss58.seq
 427952713     gbgss59.seq
 499999218     gbgss6.seq
  67665344     gbgss60.seq
 499997014     gbgss61.seq
 499998970     gbgss62.seq
 499999072     gbgss63.seq
 492396804     gbgss64.seq
 499998424     gbgss65.seq
 499998563     gbgss66.seq
 499998282     gbgss67.seq
 499998811     gbgss68.seq
   2280772     gbgss69.seq
 499997502     gbgss7.seq
 500000229     gbgss70.seq
 499999619     gbgss71.seq
 500000260     gbgss72.seq
 419366282     gbgss73.seq
 500000010     gbgss74.seq
 499997041     gbgss75.seq
 499997295     gbgss76.seq
  34859199     gbgss77.seq
 499997046     gbgss78.seq
 499999706     gbgss79.seq
 499999574     gbgss8.seq
 499999172     gbgss80.seq
 492757160     gbgss81.seq
 499998518     gbgss82.seq
 499998270     gbgss83.seq
 499998704     gbgss84.seq
 499998845     gbgss85.seq
   6746394     gbgss86.seq
 499998541     gbgss87.seq
 499997719     gbgss88.seq
 499999151     gbgss89.seq
 499998003     gbgss9.seq
 499996902     gbgss90.seq
  34174279     gbgss91.seq
 499998289     gbgss92.seq
 499998886     gbgss93.seq
 499998172     gbgss94.seq
 465185709     gbgss95.seq
 244248654     gbgss96.seq
 499999492     gbgss97.seq
 499998457     gbgss98.seq
 500000176     gbgss99.seq
 499999046     gbhtc1.seq
 499988632     gbhtc2.seq
 499995070     gbhtc3.seq
 331492497     gbhtc4.seq
 499998726     gbhtc5.seq
 440144495     gbhtc6.seq
 499997785     gbhtc7.seq
 215407243     gbhtc8.seq
 499949323     gbhtg1.seq
 499980488     gbhtg10.seq
 485100216     gbhtg11.seq
 499977040     gbhtg12.seq
 499847878     gbhtg13.seq
 499963905     gbhtg14.seq
 499701543     gbhtg15.seq
 474637795     gbhtg16.seq
 499709797     gbhtg17.seq
 499810685     gbhtg18.seq
 499965491     gbhtg19.seq
 499847286     gbhtg2.seq
 499990701     gbhtg20.seq
 473198726     gbhtg21.seq
 499919006     gbhtg22.seq
 499970126     gbhtg23.seq
 499100799     gbhtg24.seq
 499963059     gbhtg25.seq
 484453835     gbhtg26.seq
 499962395     gbhtg27.seq
 499869207     gbhtg28.seq
 268058753     gbhtg29.seq
 499869352     gbhtg3.seq
 499923133     gbhtg30.seq
 499807694     gbhtg31.seq
 224934536     gbhtg32.seq
 499945664     gbhtg33.seq
 499927322     gbhtg34.seq
 265477063     gbhtg35.seq
 499867320     gbhtg36.seq
 499972859     gbhtg37.seq
 223152241     gbhtg38.seq
 499806763     gbhtg39.seq
 499846790     gbhtg4.seq
 499975124     gbhtg40.seq
 234952969     gbhtg41.seq
 499825962     gbhtg42.seq
 499886227     gbhtg43.seq
 202125817     gbhtg44.seq
 499805593     gbhtg45.seq
 499927606     gbhtg46.seq
 205797278     gbhtg47.seq
 499977122     gbhtg48.seq
 499932310     gbhtg49.seq
 499934597     gbhtg5.seq
 193865419     gbhtg50.seq
 499930130     gbhtg51.seq
 499933430     gbhtg52.seq
 161356215     gbhtg53.seq
 499991313     gbhtg54.seq
 499991025     gbhtg55.seq
 252731354     gbhtg56.seq
 499944545     gbhtg57.seq
 499991760     gbhtg58.seq
 499843961     gbhtg59.seq
    507366     gbhtg6.seq
 167235497     gbhtg60.seq
 499935001     gbhtg61.seq
 499926029     gbhtg62.seq
 499881302     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499952537     gbhtg67.seq
 499955759     gbhtg68.seq
 499868574     gbhtg69.seq
 499821955     gbhtg7.seq
 417842665     gbhtg70.seq
 499731572     gbhtg71.seq
 499823072     gbhtg72.seq
 385408676     gbhtg73.seq
 499947980     gbhtg74.seq
 499966538     gbhtg75.seq
 383565105     gbhtg76.seq
 499960780     gbhtg77.seq
 499985376     gbhtg78.seq
 499784030     gbhtg79.seq
 499933840     gbhtg8.seq
 499757763     gbhtg80.seq
 499920642     gbhtg81.seq
 308054325     gbhtg82.seq
 499899726     gbhtg9.seq
 499921375     gbinv1.seq
 448191281     gbinv10.seq
 498462897     gbinv100.seq
 185082059     gbinv1000.se
 468046279     gbinv1001.se
 494868032     gbinv1002.se
 494549891     gbinv1003.se
 464492177     gbinv1004.se
 479062194     gbinv1005.se
 229136179     gbinv1006.se
 496620899     gbinv1007.se
 489401017     gbinv1008.se
 473706350     gbinv1009.se
 461069581     gbinv101.seq
 492517014     gbinv1010.se
 489752525     gbinv1011.se
 424310252     gbinv1012.se
 299175086     gbinv1013.se
 422085853     gbinv1014.se
 482496510     gbinv1015.se
 365476334     gbinv1016.se
 455578184     gbinv1017.se
 349492812     gbinv1018.se
 476634584     gbinv1019.se
 308472235     gbinv102.seq
 468337011     gbinv1020.se
 479253825     gbinv1021.se
 466281232     gbinv1022.se
 169424717     gbinv1023.se
 491880345     gbinv1024.se
 480699422     gbinv1025.se
 466860325     gbinv1026.se
 499811192     gbinv1027.se
  91086877     gbinv1028.se
 468973768     gbinv1029.se
 476966413     gbinv103.seq
 400459426     gbinv1030.se
2729769835     gbinv1031.se
1951209798     gbinv1032.se
1255792906     gbinv1033.se
 898357565     gbinv1034.se
 708100576     gbinv1035.se
 682258938     gbinv1036.se
 603731371     gbinv1037.se
 441414339     gbinv1038.se
 420874955     gbinv1039.se
 491653376     gbinv104.seq
 364086765     gbinv1040.se
 301244939     gbinv1041.se
 281934492     gbinv1042.se
 496007176     gbinv1043.se
 465427121     gbinv1044.se
  64629178     gbinv1045.se
 464317098     gbinv1046.se
 481015217     gbinv1047.se
 495520063     gbinv1048.se
 304368055     gbinv1049.se
 363427026     gbinv105.seq
 474561217     gbinv1050.se
 485191239     gbinv1051.se
 489426703     gbinv1052.se
 448136762     gbinv1053.se
 470740251     gbinv1054.se
 459272447     gbinv1055.se
 495221156     gbinv1056.se
 293517225     gbinv1057.se
 491531607     gbinv1058.se
 484466364     gbinv1059.se
 350760262     gbinv106.seq
 496616157     gbinv1060.se
 243887807     gbinv1061.se
 442993412     gbinv1062.se
 489594973     gbinv1063.se
 473669853     gbinv1064.se
 317058683     gbinv1065.se
 496827832     gbinv1066.se
 475806379     gbinv1067.se
 483717479     gbinv1068.se
 279303308     gbinv1069.se
 297540018     gbinv107.seq
 442658448     gbinv1070.se
 154113444     gbinv1071.se
 479808194     gbinv1072.se
 344925105     gbinv1073.se
 389948491     gbinv1074.se
 495757112     gbinv1075.se
 486177963     gbinv1076.se
 474805896     gbinv1077.se
 332242655     gbinv1078.se
 470382100     gbinv1079.se
 381801556     gbinv108.seq
 467266108     gbinv1080.se
 443778631     gbinv1081.se
 437109989     gbinv1082.se
 476924489     gbinv1083.se
 491135272     gbinv1084.se
 490968147     gbinv1085.se
 346229875     gbinv1086.se
 496167175     gbinv1087.se
 491556023     gbinv1088.se
 497588780     gbinv1089.se
 379062900     gbinv109.seq
 487095100     gbinv1090.se
 487204794     gbinv1091.se
 476212892     gbinv1092.se
 485178393     gbinv1093.se
 488738035     gbinv1094.se
 156107164     gbinv1095.se
 497392167     gbinv1096.se
 482749954     gbinv1097.se
 496261622     gbinv1098.se
 494251519     gbinv1099.se
 460975353     gbinv11.seq
 334858600     gbinv110.seq
  53213160     gbinv1100.se
 442918226     gbinv1101.se
 496050726     gbinv1102.se
 497897538     gbinv1103.se
 481565834     gbinv1104.se
  75736927     gbinv1105.se
 496194879     gbinv1106.se
 464036016     gbinv1107.se
 428298552     gbinv1108.se
 382943702     gbinv1109.se
 295805525     gbinv111.seq
 379596877     gbinv1110.se
 342671608     gbinv1111.se
 493967462     gbinv1112.se
 478563134     gbinv1113.se
 148303346     gbinv1114.se
 480732928     gbinv1115.se
 469448865     gbinv1116.se
 488160790     gbinv1117.se
 392890907     gbinv1118.se
 481357065     gbinv1119.se
 268327299     gbinv112.seq
 493413425     gbinv1120.se
 487451909     gbinv1121.se
 394846711     gbinv1122.se
 488239358     gbinv1123.se
 483834908     gbinv1124.se
 490561398     gbinv1125.se
 316655906     gbinv1126.se
 464946114     gbinv1127.se
 492014258     gbinv1128.se
 471770137     gbinv1129.se
 240539146     gbinv113.seq
 461978252     gbinv1130.se
 379959437     gbinv1131.se
 408768936     gbinv1132.se
 472794626     gbinv1133.se
 321062867     gbinv1134.se
 353308729     gbinv1135.se
 483874842     gbinv1136.se
 484350001     gbinv1137.se
 489067895     gbinv1138.se
 329008329     gbinv1139.se
 466336966     gbinv114.seq
 476668232     gbinv1140.se
 480994325     gbinv1141.se
 495891814     gbinv1142.se
 483360160     gbinv1143.se
 132911965     gbinv1144.se
 487210140     gbinv1145.se
 448992266     gbinv1146.se
 498695833     gbinv1147.se
 444078900     gbinv1148.se
 215956096     gbinv1149.se
 474680766     gbinv115.seq
 487810620     gbinv1150.se
 482286892     gbinv1151.se
 497441252     gbinv1152.se
 467821328     gbinv1153.se
 154246756     gbinv1154.se
 466393483     gbinv1155.se
 489416936     gbinv1156.se
 498094362     gbinv1157.se
 484048889     gbinv1158.se
 107559872     gbinv1159.se
 466347402     gbinv116.seq
 496101873     gbinv1160.se
 486677933     gbinv1161.se
 491324260     gbinv1162.se
 473165407     gbinv1163.se
 140712569     gbinv1164.se
 498375180     gbinv1165.se
 479763923     gbinv1166.se
 484976323     gbinv1167.se
 482273285     gbinv1168.se
 478828590     gbinv1169.se
  87043104     gbinv117.seq
 491989005     gbinv1170.se
 447463190     gbinv1171.se
 487986285     gbinv1172.se
 346424265     gbinv1173.se
 460874738     gbinv1174.se
 470352434     gbinv1175.se
 496569150     gbinv1176.se
 495212210     gbinv1177.se
 443889162     gbinv1178.se
 496692637     gbinv1179.se
 454196228     gbinv118.seq
 473301815     gbinv1180.se
 493531126     gbinv1181.se
 483258684     gbinv1182.se
 403143105     gbinv1183.se
 492287961     gbinv1184.se
 492993389     gbinv1185.se
 329034299     gbinv1186.se
 461827784     gbinv1187.se
 482686927     gbinv1188.se
  99362650     gbinv1189.se
 437093110     gbinv119.seq
 443724048     gbinv1190.se
 367763998     gbinv1191.se
 353268604     gbinv1192.se
 350260612     gbinv1193.se
 341599132     gbinv1194.se
 461028723     gbinv1195.se
 495674250     gbinv1196.se
 283813945     gbinv1197.se
 495723890     gbinv1198.se
 495292964     gbinv1199.se
 470405378     gbinv12.seq
 477521665     gbinv120.seq
 476664181     gbinv1200.se
 446428554     gbinv1201.se
 382810689     gbinv1202.se
 448082904     gbinv1203.se
 453192257     gbinv1204.se
 484511211     gbinv1205.se
 284284487     gbinv1206.se
 476862131     gbinv1207.se
 464518126     gbinv1208.se
 496023268     gbinv1209.se
 438315290     gbinv121.seq
 484057968     gbinv1210.se
  64752815     gbinv1211.se
 453621523     gbinv1212.se
 477654378     gbinv1213.se
 484267949     gbinv1214.se
 455437646     gbinv1215.se
  89115533     gbinv1216.se
 483404516     gbinv1217.se
 390899518     gbinv1218.se
 452325242     gbinv1219.se
 495970164     gbinv122.seq
 384613513     gbinv1220.se
 229526122     gbinv1221.se
 486991783     gbinv1222.se
 496712223     gbinv1223.se
 435108906     gbinv1224.se
 287148864     gbinv1225.se
 277496405     gbinv1226.se
 488197542     gbinv1227.se
 493608297     gbinv1228.se
 489917099     gbinv1229.se
 494841338     gbinv123.seq
 468604289     gbinv1230.se
  78075814     gbinv1231.se
 463954346     gbinv1232.se
 444065721     gbinv1233.se
 463448466     gbinv1234.se
 479934750     gbinv1235.se
 498795321     gbinv1236.se
 472901111     gbinv1237.se
 163240230     gbinv1238.se
 487102736     gbinv1239.se
 477525729     gbinv124.seq
 492609813     gbinv1240.se
 481436962     gbinv1241.se
 460938379     gbinv1242.se
 478440248     gbinv1243.se
 498750906     gbinv1244.se
 164930006     gbinv1245.se
 492943115     gbinv1246.se
 490618893     gbinv1247.se
 492915933     gbinv1248.se
 480868563     gbinv1249.se
 483902052     gbinv125.seq
 489548617     gbinv1250.se
 493048930     gbinv1251.se
 481728782     gbinv1252.se
 491049473     gbinv1253.se
 497816475     gbinv1254.se
 349702816     gbinv1255.se
 480059395     gbinv1256.se
 384338991     gbinv1257.se
 495415147     gbinv1258.se
 494914864     gbinv1259.se
 499996067     gbinv126.seq
 464264813     gbinv1260.se
 412697818     gbinv1261.se
 493232928     gbinv1262.se
 486605755     gbinv1263.se
 476585175     gbinv1264.se
 199064605     gbinv1265.se
 490754089     gbinv1266.se
 472244532     gbinv1267.se
 489706010     gbinv1268.se
 464236921     gbinv1269.se
 101805538     gbinv127.seq
 467204993     gbinv1270.se
 499827123     gbinv1271.se
 345613253     gbinv1272.se
 483950049     gbinv1273.se
 478586227     gbinv1274.se
  94225785     gbinv1275.se
 472428904     gbinv1276.se
 497885447     gbinv1277.se
 457902545     gbinv1278.se
 498796484     gbinv1279.se
 499995747     gbinv128.seq
 467125389     gbinv1280.se
 497244361     gbinv1281.se
 487538660     gbinv1282.se
 499913920     gbinv1283.se
 406549774     gbinv1284.se
 430451685     gbinv1285.se
 472260007     gbinv1286.se
 475352175     gbinv1287.se
 452223380     gbinv1288.se
 497325130     gbinv1289.se
 406815642     gbinv129.seq
 494398316     gbinv1290.se
  54910173     gbinv1291.se
 492423538     gbinv1292.se
 491678341     gbinv1293.se
 467975788     gbinv1294.se
 477888370     gbinv1295.se
 439149787     gbinv1296.se
 107820209     gbinv1297.se
 491773954     gbinv1298.se
 479110373     gbinv1299.se
 485779138     gbinv13.seq
 497592612     gbinv130.seq
 496707613     gbinv1300.se
 498528229     gbinv1301.se
 462735347     gbinv1302.se
 402849455     gbinv1303.se
 491032865     gbinv1304.se
 476073140     gbinv1305.se
 456931139     gbinv1306.se
 478083309     gbinv1307.se
 457571010     gbinv1308.se
 490220501     gbinv1309.se
 491627608     gbinv131.seq
  26121678     gbinv1310.se
 481108642     gbinv1311.se
 343565210     gbinv1312.se
 496752688     gbinv1313.se
 480731694     gbinv1314.se
 470531307     gbinv1315.se
 483531381     gbinv1316.se
  74062948     gbinv1317.se
 432713903     gbinv1318.se
 469121536     gbinv1319.se
 468890974     gbinv132.seq
 488318181     gbinv1320.se
 457907158     gbinv1321.se
 288589895     gbinv1322.se
 413758380     gbinv1323.se
 227750852     gbinv1324.se
 499653408     gbinv1325.se
 263948525     gbinv1326.se
 490736102     gbinv1327.se
 499126557     gbinv1328.se
 490773865     gbinv1329.se
 480496392     gbinv133.seq
 480867825     gbinv1330.se
 488870121     gbinv1331.se
 158318713     gbinv1332.se
 494916186     gbinv1333.se
 471135774     gbinv1334.se
 484279868     gbinv1335.se
 469898457     gbinv1336.se
 461055681     gbinv1337.se
 273724334     gbinv1338.se
 281877207     gbinv1339.se
  96954550     gbinv134.seq
 479356634     gbinv1340.se
 463004791     gbinv1341.se
 225686207     gbinv1342.se
 489637921     gbinv1343.se
 496465279     gbinv1344.se
 484561817     gbinv1345.se
 477308789     gbinv1346.se
 258133115     gbinv1347.se
 493072880     gbinv1348.se
 490208988     gbinv1349.se
 495716317     gbinv135.seq
 492809523     gbinv1350.se
 474012633     gbinv1351.se
 200353570     gbinv1352.se
 477986454     gbinv1353.se
 491870466     gbinv1354.se
 472046257     gbinv1355.se
 484787948     gbinv1356.se
 240176778     gbinv1357.se
 481405748     gbinv1358.se
 492731277     gbinv1359.se
 459725127     gbinv136.seq
 480851291     gbinv1360.se
 381859195     gbinv1361.se
 479236800     gbinv1362.se
 489743792     gbinv1363.se
 497574828     gbinv1364.se
 381267248     gbinv1365.se
 450448665     gbinv1366.se
 484530441     gbinv1367.se
 394299446     gbinv1368.se
 425501799     gbinv1369.se
 481987025     gbinv137.seq
 115618359     gbinv1370.se
 431451977     gbinv1371.se
 498054878     gbinv1372.se
 479298950     gbinv1373.se
 467089340     gbinv1374.se
  70651447     gbinv1375.se
 278258267     gbinv1376.se
 440773903     gbinv1377.se
 470493499     gbinv1378.se
 476778459     gbinv1379.se
 494130819     gbinv138.seq
 486736873     gbinv1380.se
 223420398     gbinv1381.se
 471322661     gbinv1382.se
 489692789     gbinv1383.se
 493687885     gbinv1384.se
 389895514     gbinv1385.se
 489638363     gbinv1386.se
  35794018     gbinv1387.se
 115155809     gbinv1388.se
 615537581     gbinv1389.se
 170883605     gbinv139.seq
 272202298     gbinv1390.se
 480149302     gbinv1391.se
 476834871     gbinv1392.se
 477140077     gbinv1393.se
 491640835     gbinv1394.se
 403386359     gbinv1395.se
 297511488     gbinv1396.se
 400332784     gbinv1397.se
 498823027     gbinv1398.se
 483203009     gbinv1399.se
 459258045     gbinv14.seq
 473739682     gbinv140.seq
 482735960     gbinv1400.se
 489718628     gbinv1401.se
 494917649     gbinv1402.se
 464038514     gbinv1403.se
 489339776     gbinv1404.se
 491072844     gbinv1405.se
 485392941     gbinv1406.se
 485744082     gbinv1407.se
 436679683     gbinv1408.se
 104870652     gbinv1409.se
 489734098     gbinv141.seq
 487890253     gbinv1410.se
 491469693     gbinv1411.se
 492207810     gbinv1412.se
 277662520     gbinv1413.se
 465038797     gbinv1414.se
 484906173     gbinv1415.se
 455274642     gbinv1416.se
 319919307     gbinv1417.se
 441284320     gbinv1418.se
 415113809     gbinv1419.se
 481853020     gbinv142.seq
 401299897     gbinv1420.se
 395865604     gbinv1421.se
 258909090     gbinv1422.se
 514655388     gbinv1423.se
 393855324     gbinv1424.se
 492709181     gbinv1425.se
 187722486     gbinv1426.se
 316437995     gbinv1427.se
 404935920     gbinv1428.se
 377659133     gbinv1429.se
 480575066     gbinv143.seq
 357065535     gbinv1430.se
 306211988     gbinv1431.se
 475517285     gbinv1432.se
 487075677     gbinv1433.se
 416387225     gbinv1434.se
 134695954     gbinv1435.se
 430211421     gbinv1436.se
 468408575     gbinv1437.se
 436825552     gbinv1438.se
 499430139     gbinv1439.se
 175803757     gbinv144.seq
 151862240     gbinv1440.se
 462552718     gbinv1441.se
 491611432     gbinv1442.se
 498143107     gbinv1443.se
 338205053     gbinv1444.se
 497160898     gbinv1445.se
 493529280     gbinv1446.se
 490583969     gbinv1447.se
 296798816     gbinv1448.se
 327269135     gbinv1449.se
 495896562     gbinv145.seq
 374578168     gbinv1450.se
 464846984     gbinv1451.se
 483112113     gbinv1452.se
 134997033     gbinv1453.se
 435630019     gbinv1454.se
 484610659     gbinv1455.se
 421495202     gbinv1456.se
 397549582     gbinv1457.se
 481528936     gbinv1458.se
 458589607     gbinv1459.se
 496714826     gbinv146.seq
 472513592     gbinv1460.se
 337603339     gbinv1461.se
 484201127     gbinv1462.se
 385978713     gbinv1463.se
 440431049     gbinv1464.se
 460502362     gbinv1465.se
 495623919     gbinv1466.se
 476021491     gbinv1467.se
 461121425     gbinv1468.se
 344726041     gbinv1469.se
 484083643     gbinv147.seq
 460975459     gbinv1470.se
 487003903     gbinv1471.se
 498520425     gbinv1472.se
 418134448     gbinv1473.se
 427253029     gbinv1474.se
 486412807     gbinv1475.se
 383942184     gbinv1476.se
 477338574     gbinv1477.se
 490073097     gbinv1478.se
 478811262     gbinv1479.se
 472142529     gbinv148.seq
 496060117     gbinv1480.se
 340406228     gbinv1481.se
 449114541     gbinv1482.se
 199251506     gbinv1483.se
 221729756     gbinv1484.se
 327938029     gbinv1485.se
 425282426     gbinv1486.se
 313687149     gbinv1487.se
 266841778     gbinv1488.se
 458869871     gbinv1489.se
 487970521     gbinv149.seq
 369422706     gbinv1490.se
 153606987     gbinv1491.se
 472914403     gbinv1492.se
 306852781     gbinv1493.se
 291548062     gbinv1494.se
 272671608     gbinv1495.se
 486703218     gbinv1496.se
 499913313     gbinv1497.se
 491927835     gbinv1498.se
 158294388     gbinv1499.se
 484230611     gbinv15.seq
 473212644     gbinv150.seq
 470404301     gbinv1500.se
 477785110     gbinv1501.se
 401558910     gbinv1502.se
 482108666     gbinv1503.se
  75176389     gbinv1504.se
 466305691     gbinv1505.se
 488346628     gbinv1506.se
 427690357     gbinv1507.se
 413354153     gbinv1508.se
 497212607     gbinv1509.se
 119585424     gbinv151.seq
 400793181     gbinv1510.se
 484524034     gbinv1511.se
 465540714     gbinv1512.se
 498576546     gbinv1513.se
 406206788     gbinv1514.se
 453652425     gbinv1515.se
 457851234     gbinv1516.se
 392940138     gbinv1517.se
 484114705     gbinv1518.se
 485175842     gbinv1519.se
 483414568     gbinv152.seq
 489823569     gbinv1520.se
 493576473     gbinv1521.se
 177016892     gbinv1522.se
 486849466     gbinv1523.se
 480897370     gbinv1524.se
 254718644     gbinv1525.se
 271476686     gbinv1526.se
 459218955     gbinv1527.se
 436464597     gbinv1528.se
 424836755     gbinv1529.se
 490356176     gbinv153.seq
 407409473     gbinv1530.se
 392557971     gbinv1531.se
 374840311     gbinv1532.se
 370687455     gbinv1533.se
 364209018     gbinv1534.se
 356043378     gbinv1535.se
 470407388     gbinv1536.se
 498144179     gbinv1537.se
 440247259     gbinv1538.se
 432569025     gbinv1539.se
 487648026     gbinv154.seq
 473074066     gbinv1540.se
 446787735     gbinv1541.se
 490046306     gbinv1542.se
 458546137     gbinv1543.se
 453744056     gbinv1544.se
 485719553     gbinv1545.se
 470688947     gbinv1546.se
 499145969     gbinv1547.se
 488679526     gbinv1548.se
 383236752     gbinv1549.se
 482729414     gbinv155.seq
 403063473     gbinv1550.se
 491935868     gbinv1551.se
 450996388     gbinv1552.se
 494574942     gbinv1553.se
 190754233     gbinv1554.se
 446572734     gbinv1555.se
 349707818     gbinv1556.se
 498341839     gbinv1557.se
 475083978     gbinv1558.se
 495586255     gbinv1559.se
 499999581     gbinv156.seq
 493047765     gbinv1560.se
 424336607     gbinv1561.se
 445635419     gbinv1562.se
 496536598     gbinv1563.se
 421970194     gbinv1564.se
 304852181     gbinv1565.se
 282782605     gbinv1566.se
 287459144     gbinv1567.se
 292138330     gbinv1568.se
 278622574     gbinv1569.se
 420970303     gbinv157.seq
 464187388     gbinv1570.se
 365807256     gbinv1571.se
 473318223     gbinv1572.se
 397532595     gbinv1573.se
 499926253     gbinv1574.se
 489834503     gbinv1575.se
 494009263     gbinv1576.se
 227606738     gbinv1577.se
 354335913     gbinv1578.se
 405308849     gbinv1579.se
 485186926     gbinv158.seq
 373295374     gbinv1580.se
 461408168     gbinv1581.se
 468585870     gbinv1582.se
 465615394     gbinv1583.se
 478206747     gbinv1584.se
 470845488     gbinv1585.se
 434630573     gbinv1586.se
 449352694     gbinv1587.se
 475961503     gbinv1588.se
 499526122     gbinv1589.se
 497652223     gbinv159.seq
 474588030     gbinv1590.se
 497424296     gbinv1591.se
 495010727     gbinv1592.se
 473393329     gbinv1593.se
 492895518     gbinv1594.se
 433798578     gbinv1595.se
 497380186     gbinv1596.se
 478698569     gbinv1597.se
 493900539     gbinv1598.se
 448881029     gbinv1599.se
 495961065     gbinv16.seq
 492273365     gbinv160.seq
 491287252     gbinv1600.se
 486729373     gbinv1601.se
 490419273     gbinv1602.se
 466942698     gbinv1603.se
 496628250     gbinv1604.se
 415334432     gbinv1605.se
 477729034     gbinv1606.se
 389608539     gbinv1607.se
 447782896     gbinv1608.se
 379570416     gbinv1609.se
 493650305     gbinv161.seq
 168050660     gbinv1610.se
 402140341     gbinv1611.se
 498521166     gbinv1612.se
 487560937     gbinv1613.se
 470237421     gbinv1614.se
 251883025     gbinv1615.se
 450021867     gbinv1616.se
 456014148     gbinv1617.se
 424453416     gbinv1618.se
 489077138     gbinv1619.se
 319412812     gbinv162.seq
 291935973     gbinv1620.se
 447199297     gbinv1621.se
 482287346     gbinv1622.se
 446762057     gbinv1623.se
 478107977     gbinv1624.se
 499941570     gbinv1625.se
 250754094     gbinv1626.se
 426775075     gbinv1627.se
 469944018     gbinv1628.se
 421658854     gbinv1629.se
 495488980     gbinv163.seq
 156531103     gbinv1630.se
 424023494     gbinv1631.se
 458403575     gbinv1632.se
 760558437     gbinv1633.se
 630932111     gbinv1634.se
 348282103     gbinv1635.se
 482864667     gbinv1636.se
 482420426     gbinv1637.se
 481162029     gbinv1638.se
 476708177     gbinv1639.se
 496723739     gbinv164.seq
 478452282     gbinv1640.se
  98056964     gbinv1641.se
 367764030     gbinv1642.se
 492318902     gbinv1643.se
 465538889     gbinv1644.se
 440087513     gbinv1645.se
 402923832     gbinv1646.se
 293890829     gbinv1647.se
 480424893     gbinv1648.se
 487780990     gbinv1649.se
 492757168     gbinv165.seq
 497662462     gbinv1650.se
 493315557     gbinv1651.se
 454184050     gbinv1652.se
 453672339     gbinv1653.se
 477783541     gbinv1654.se
 396639389     gbinv1655.se
 258248902     gbinv1656.se
 457972032     gbinv1657.se
 493145244     gbinv1658.se
  83808633     gbinv1659.se
 483899601     gbinv166.seq
 481310336     gbinv1660.se
 484438327     gbinv1661.se
 431604389     gbinv1662.se
 466521191     gbinv1663.se
 479481937     gbinv1664.se
 203515617     gbinv1665.se
 438666095     gbinv1666.se
 288710027     gbinv1667.se
 587646776     gbinv1668.se
 521821380     gbinv1669.se
 478256053     gbinv167.seq
 488633320     gbinv1670.se
 484849194     gbinv1671.se
 494691429     gbinv1672.se
  84878173     gbinv1673.se
 474082897     gbinv1674.se
 328282042     gbinv1675.se
 429294922     gbinv1676.se
 376618222     gbinv1677.se
 465450082     gbinv1678.se
 191733239     gbinv1679.se
 492780857     gbinv168.seq
 413988002     gbinv1680.se
 346233485     gbinv1681.se
 351456130     gbinv1682.se
 332888212     gbinv1683.se
 344512888     gbinv1684.se
 161969290     gbinv1685.se
 466172748     gbinv1686.se
 443973599     gbinv1687.se
 439364738     gbinv1688.se
 492660163     gbinv1689.se
 499976012     gbinv169.seq
 421482701     gbinv1690.se
 494043084     gbinv1691.se
 349286868     gbinv1692.se
 401241900     gbinv1693.se
 478917983     gbinv1694.se
 476837170     gbinv1695.se
 489355798     gbinv1696.se
 455471572     gbinv1697.se
 498384166     gbinv1698.se
 319485498     gbinv1699.se
 498728841     gbinv17.seq
 498322008     gbinv170.seq
 499130515     gbinv1700.se
 487864427     gbinv1701.se
 493398968     gbinv1702.se
 485556197     gbinv1703.se
 485364037     gbinv1704.se
 484935088     gbinv1705.se
 466357014     gbinv1706.se
 457733117     gbinv1707.se
 392915750     gbinv1708.se
 478478032     gbinv1709.se
 483551083     gbinv171.seq
 393129850     gbinv1710.se
 492543588     gbinv1711.se
 450108923     gbinv1712.se
 351978698     gbinv1713.se
 478292534     gbinv1714.se
 420767553     gbinv1715.se
 481749728     gbinv1716.se
 445278271     gbinv1717.se
 412662975     gbinv1718.se
 387090079     gbinv1719.se
 444451723     gbinv172.seq
 256908256     gbinv1720.se
 469736436     gbinv1721.se
 490540910     gbinv1722.se
 485878260     gbinv1723.se
 465587474     gbinv1724.se
 480998150     gbinv1725.se
 465832905     gbinv1726.se
 485326493     gbinv1727.se
 433309101     gbinv1728.se
 440675008     gbinv1729.se
 483770018     gbinv173.seq
  68735845     gbinv1730.se
 450845716     gbinv1731.se
 313135865     gbinv1732.se
 429536528     gbinv1733.se
 394632639     gbinv1734.se
 476444266     gbinv1735.se
 496585001     gbinv1736.se
 484815304     gbinv1737.se
 498211104     gbinv1738.se
 490032585     gbinv1739.se
 493576167     gbinv174.seq
  88986595     gbinv1740.se
 499092910     gbinv1741.se
 471084800     gbinv1742.se
 479084211     gbinv1743.se
 458027456     gbinv1744.se
 183437281     gbinv1745.se
 489133522     gbinv1746.se
 480973066     gbinv1747.se
 476620478     gbinv1748.se
 484763605     gbinv1749.se
 498160027     gbinv175.seq
 172605670     gbinv1750.se
 476872305     gbinv1751.se
 497217757     gbinv1752.se
 454084009     gbinv1753.se
 490687872     gbinv1754.se
 249163765     gbinv1755.se
 446287432     gbinv1756.se
 480747279     gbinv1757.se
 477662208     gbinv1758.se
 486024070     gbinv1759.se
 461241055     gbinv176.seq
 138543432     gbinv1760.se
 363404243     gbinv1761.se
 440303391     gbinv1762.se
 428374310     gbinv1763.se
 485262912     gbinv1764.se
 313605393     gbinv1765.se
 384773620     gbinv1766.se
 344575448     gbinv1767.se
 302995972     gbinv1768.se
 489532826     gbinv1769.se
 429126369     gbinv177.seq
 205630096     gbinv1770.se
 469243590     gbinv1771.se
 491841323     gbinv1772.se
 478814364     gbinv1773.se
 449053948     gbinv1774.se
 480874694     gbinv1775.se
 305311722     gbinv1776.se
 455945961     gbinv1777.se
 299250305     gbinv1778.se
 480931807     gbinv1779.se
 472246082     gbinv178.seq
 439984634     gbinv1780.se
 406664054     gbinv1781.se
 381577942     gbinv1782.se
 185200260     gbinv1783.se
 349601440     gbinv1784.se
 480401561     gbinv1785.se
 483626729     gbinv1786.se
 247425526     gbinv1787.se
 407101180     gbinv1788.se
 364334325     gbinv1789.se
 487388602     gbinv179.seq
 459985559     gbinv1790.se
 404003999     gbinv1791.se
 268459648     gbinv1792.se
 477702099     gbinv1793.se
 460168850     gbinv1794.se
 478963154     gbinv1795.se
 324699595     gbinv1796.se
 491566844     gbinv1797.se
 484918227     gbinv1798.se
 471411039     gbinv1799.se
 485356809     gbinv18.seq
 488621132     gbinv180.seq
 401957469     gbinv1800.se
 174828331     gbinv1801.se
 456950968     gbinv1802.se
 452653049     gbinv1803.se
 439521990     gbinv1804.se
 469069239     gbinv1805.se
 403378951     gbinv1806.se
 498968159     gbinv1807.se
 489660738     gbinv1808.se
 447280245     gbinv1809.se
 492386538     gbinv181.seq
 491313358     gbinv1810.se
 473371583     gbinv1811.se
 421938580     gbinv1812.se
 461808273     gbinv1813.se
 499047170     gbinv1814.se
 448428578     gbinv1815.se
 478899995     gbinv1816.se
 433199933     gbinv1817.se
 447202279     gbinv1818.se
 499645462     gbinv1819.se
 410012642     gbinv182.seq
 499728235     gbinv1820.se
 281848846     gbinv1821.se
 350069691     gbinv1822.se
 276080178     gbinv1823.se
 249584187     gbinv1824.se
 482294957     gbinv1825.se
 432625059     gbinv1826.se
 390302552     gbinv1827.se
 356463371     gbinv1828.se
 434548133     gbinv1829.se
 489753866     gbinv183.seq
 499992092     gbinv1830.se
 112301803     gbinv1831.se
 498992007     gbinv1832.se
 493005878     gbinv1833.se
 494399781     gbinv1834.se
 463657580     gbinv1835.se
 486200575     gbinv1836.se
 296149363     gbinv1837.se
 404122235     gbinv1838.se
 299824557     gbinv1839.se
 486908019     gbinv184.seq
 289913425     gbinv1840.se
 253773333     gbinv1841.se
 504406615     gbinv1842.se
 502660531     gbinv1843.se
 462708296     gbinv1844.se
 343800410     gbinv1845.se
 304171260     gbinv1846.se
 296432606     gbinv1847.se
 282298128     gbinv1848.se
 281277784     gbinv1849.se
 475277294     gbinv185.seq
 272065061     gbinv1850.se
 264586044     gbinv1851.se
 488282800     gbinv1852.se
 220144679     gbinv1853.se
 416658392     gbinv1854.se
 355528545     gbinv1855.se
 440867432     gbinv1856.se
 406695325     gbinv1857.se
 485520087     gbinv1858.se
 456871825     gbinv1859.se
 499301159     gbinv186.seq
 285317935     gbinv1860.se
 435573273     gbinv1861.se
 495486079     gbinv1862.se
 478791254     gbinv1863.se
 362223580     gbinv1864.se
 463548723     gbinv1865.se
 446713082     gbinv1866.se
 492755543     gbinv1867.se
 479071997     gbinv1868.se
  94856663     gbinv1869.se
 356777678     gbinv187.seq
 487346963     gbinv1870.se
 486480531     gbinv1871.se
 491518484     gbinv1872.se
 499253247     gbinv1873.se
 492100745     gbinv1874.se
 240584427     gbinv1875.se
 473910512     gbinv1876.se
 467512893     gbinv1877.se
 489494146     gbinv1878.se
 432756723     gbinv1879.se
 461771503     gbinv188.seq
 484035489     gbinv1880.se
 490412203     gbinv1881.se
 431205884     gbinv1882.se
 494114749     gbinv1883.se
 449713451     gbinv1884.se
 434434579     gbinv1885.se
 394577865     gbinv1886.se
 374337630     gbinv1887.se
 171037229     gbinv1888.se
 480706996     gbinv1889.se
 479426529     gbinv189.seq
 480578541     gbinv1890.se
 455876315     gbinv1891.se
 479858717     gbinv1892.se
 499257335     gbinv1893.se
 497855628     gbinv1894.se
  27351233     gbinv1895.se
 411621973     gbinv1896.se
 378984421     gbinv1897.se
 459159097     gbinv1898.se
 490406125     gbinv1899.se
 453160467     gbinv19.seq
 494640587     gbinv190.seq
 466526746     gbinv1900.se
 450347862     gbinv1901.se
 371076512     gbinv1902.se
 470003998     gbinv1903.se
 480725717     gbinv1904.se
 495111554     gbinv1905.se
 489257512     gbinv1906.se
 484731464     gbinv1907.se
 458372509     gbinv1908.se
 147355819     gbinv1909.se
 328489973     gbinv191.seq
 474361640     gbinv1910.se
 443924586     gbinv1911.se
 447614380     gbinv1912.se
 476378024     gbinv1913.se
 499602750     gbinv1914.se
 373191394     gbinv1915.se
 383648458     gbinv1916.se
 497243375     gbinv1917.se
 440587307     gbinv1918.se
 467050705     gbinv1919.se
 484117251     gbinv192.seq
 336898451     gbinv1920.se
 440552084     gbinv1921.se
 485125937     gbinv1922.se
 434540695     gbinv1923.se
 349654018     gbinv1924.se
 350272897     gbinv1925.se
 486089196     gbinv1926.se
 167675005     gbinv1927.se
 476464424     gbinv1928.se
 486534701     gbinv1929.se
 499996770     gbinv193.seq
 486900331     gbinv1930.se
 489674973     gbinv1931.se
 277527107     gbinv1932.se
 472044955     gbinv1933.se
 499227647     gbinv1934.se
 246704369     gbinv1935.se
 285322994     gbinv1936.se
 261613424     gbinv1937.se
 499652642     gbinv1938.se
 452085451     gbinv1939.se
 499998369     gbinv194.seq
 404472936     gbinv1940.se
 388757396     gbinv1941.se
 360024243     gbinv1942.se
 346007741     gbinv1943.se
 451355949     gbinv1944.se
 498149041     gbinv1945.se
 435130352     gbinv1946.se
 498313048     gbinv1947.se
 489839164     gbinv1948.se
 494750227     gbinv1949.se
 116594649     gbinv195.seq
  80427650     gbinv1950.se
 483771533     gbinv1951.se
 422193854     gbinv1952.se
 483507579     gbinv1953.se
 488710958     gbinv1954.se
 340423353     gbinv1955.se
 251026038     gbinv1956.se
 421480407     gbinv1957.se
 380506998     gbinv1958.se
 469295978     gbinv1959.se
 499999074     gbinv196.seq
 491267604     gbinv1960.se
 226895576     gbinv1961.se
 401977202     gbinv1962.se
 396971438     gbinv1963.se
 367984786     gbinv1964.se
 340174466     gbinv1965.se
 335837652     gbinv1966.se
 166168804     gbinv1967.se
 467664520     gbinv1968.se
 448836068     gbinv1969.se
 499997883     gbinv197.seq
 406993985     gbinv1970.se
 496254260     gbinv1971.se
 120918885     gbinv1972.se
 468156859     gbinv1973.se
 425813495     gbinv1974.se
 479520730     gbinv1975.se
 472363774     gbinv1976.se
 277909672     gbinv1977.se
 436991083     gbinv1978.se
 482639712     gbinv1979.se
 405208730     gbinv198.seq
 348873045     gbinv1980.se
 440487652     gbinv1981.se
 435724062     gbinv1982.se
 469805706     gbinv1983.se
 479738839     gbinv1984.se
 478060773     gbinv1985.se
 494922118     gbinv1986.se
 235454577     gbinv1987.se
 476341765     gbinv1988.se
 366934109     gbinv1989.se
 499997036     gbinv199.seq
 355366231     gbinv1990.se
 469519030     gbinv1991.se
 483902663     gbinv1992.se
  99369574     gbinv1993.se
  93113666     gbinv1994.se
 422271007     gbinv1995.se
 399120203     gbinv1996.se
 496728551     gbinv1997.se
 499561060     gbinv1998.se
 470362613     gbinv1999.se
 457496457     gbinv2.seq
 497427024     gbinv20.seq
 499998228     gbinv200.seq
 150185251     gbinv2000.se
 685164991     gbinv2001.se
 629739282     gbinv2002.se
 419098526     gbinv2003.se
 389823796     gbinv2004.se
 498119988     gbinv2005.se
 393720255     gbinv2006.se
 471500654     gbinv2007.se
 481116573     gbinv2008.se
  95705375     gbinv2009.se
 181464670     gbinv201.seq
 468616569     gbinv2010.se
 292241470     gbinv2011.se
 290625223     gbinv2012.se
 437150325     gbinv2013.se
 409335174     gbinv2014.se
 303275686     gbinv2015.se
 491069326     gbinv2016.se
 399314261     gbinv2017.se
 475414946     gbinv2018.se
 430435061     gbinv2019.se
 499997734     gbinv202.seq
 467203257     gbinv2020.se
 491685198     gbinv2021.se
 490122539     gbinv2022.se
 443572312     gbinv2023.se
 414874046     gbinv2024.se
 372396028     gbinv2025.se
 495207624     gbinv2026.se
 444023668     gbinv2027.se
 472068210     gbinv2028.se
 472293593     gbinv2029.se
 500000133     gbinv203.seq
 396294345     gbinv2030.se
 458536775     gbinv2031.se
 430505491     gbinv2032.se
 471312153     gbinv2033.se
 478183752     gbinv2034.se
 468151023     gbinv2035.se
 499390700     gbinv2036.se
 193131369     gbinv2037.se
 460077026     gbinv2038.se
 489489263     gbinv2039.se
 125104375     gbinv204.seq
 425166824     gbinv2040.se
 493385482     gbinv2041.se
 488493611     gbinv2042.se
 380056149     gbinv2043.se
 335743780     gbinv2044.se
 472528563     gbinv2045.se
 416074978     gbinv2046.se
 480828988     gbinv2047.se
 428654064     gbinv2048.se
 176622680     gbinv2049.se
 499998194     gbinv205.seq
 447970688     gbinv2050.se
 486961944     gbinv2051.se
 365582043     gbinv2052.se
 400186520     gbinv2053.se
 152136774     gbinv2054.se
 472134370     gbinv2055.se
 389423826     gbinv2056.se
 321441155     gbinv2057.se
 319780544     gbinv2058.se
 474932352     gbinv2059.se
 499998698     gbinv206.seq
 484567075     gbinv2060.se
 478403348     gbinv2061.se
 497752321     gbinv2062.se
 384248486     gbinv2063.se
 487356355     gbinv2064.se
 268179846     gbinv2065.se
 394121999     gbinv2066.se
 389616276     gbinv2067.se
 492719310     gbinv2068.se
 330165617     gbinv2069.se
 151322108     gbinv207.seq
 476397436     gbinv2070.se
 585505873     gbinv2071.se
 542341005     gbinv2072.se
 493331060     gbinv2073.se
 243355874     gbinv2074.se
 483024917     gbinv2075.se
 476781937     gbinv2076.se
 487274340     gbinv2077.se
 486478573     gbinv2078.se
 405262036     gbinv2079.se
 499997404     gbinv208.seq
  96364297     gbinv2080.se
 441214482     gbinv2081.se
 499281998     gbinv2082.se
 485174234     gbinv2083.se
 452268479     gbinv2084.se
 494685555     gbinv2085.se
 480316704     gbinv2086.se
 441835336     gbinv2087.se
 477607772     gbinv2088.se
 487324376     gbinv2089.se
 499999137     gbinv209.seq
 180631805     gbinv2090.se
 489041947     gbinv2091.se
 498480584     gbinv2092.se
 483924716     gbinv2093.se
 472344254     gbinv2094.se
 461666211     gbinv2095.se
 155235462     gbinv2096.se
 478779437     gbinv2097.se
 484495136     gbinv2098.se
 494398404     gbinv2099.se
 476460093     gbinv21.seq
 155222552     gbinv210.seq
 401955888     gbinv2100.se
 484632866     gbinv2101.se
 419719218     gbinv2102.se
 435624958     gbinv2103.se
 468669166     gbinv2104.se
  90808886     gbinv2105.se
 488197504     gbinv2106.se
 446823195     gbinv2107.se
 499183385     gbinv2108.se
 478594914     gbinv2109.se
 499998922     gbinv211.seq
 490939464     gbinv2110.se
 472135475     gbinv2111.se
 484363141     gbinv2112.se
 369004656     gbinv2113.se
 492288068     gbinv2114.se
 485810172     gbinv2115.se
 475723818     gbinv2116.se
 416034420     gbinv2117.se
 459385495     gbinv2118.se
 205005967     gbinv2119.se
 499999382     gbinv212.seq
 471023337     gbinv2120.se
 299089605     gbinv2121.se
 400971851     gbinv2122.se
 339697668     gbinv2123.se
 337569217     gbinv2124.se
 275391490     gbinv2125.se
 486170976     gbinv2126.se
 481605244     gbinv2127.se
 454398203     gbinv2128.se
 492958974     gbinv2129.se
 188834254     gbinv213.seq
 347880334     gbinv2130.se
 445095337     gbinv2131.se
 334450818     gbinv2132.se
 262742772     gbinv2133.se
 447729907     gbinv2134.se
 496311336     gbinv2135.se
 464938229     gbinv2136.se
 494372235     gbinv2137.se
 472121956     gbinv2138.se
 413672647     gbinv2139.se
 499997560     gbinv214.seq
 435343439     gbinv2140.se
 335449507     gbinv2141.se
 329860465     gbinv2142.se
 237717680     gbinv2143.se
 421224834     gbinv2144.se
 312762764     gbinv2145.se
 306193421     gbinv2146.se
 295210234     gbinv2147.se
 473158141     gbinv2148.se
 498210290     gbinv2149.se
 499999311     gbinv215.seq
 488860842     gbinv2150.se
 463925560     gbinv2151.se
 671628695     gbinv2152.se
 499084111     gbinv2153.se
 392671020     gbinv2154.se
 496375358     gbinv2155.se
 295588392     gbinv2156.se
 421050588     gbinv2157.se
 397951635     gbinv2158.se
 499540200     gbinv2159.se
 245882870     gbinv216.seq
 479607477     gbinv2160.se
 112456434     gbinv2161.se
 492624739     gbinv2162.se
 399527665     gbinv2163.se
 376326748     gbinv2164.se
 470560734     gbinv2165.se
 132600082     gbinv2166.se
 422475887     gbinv2167.se
 490649761     gbinv2168.se
 337601558     gbinv2169.se
 499999664     gbinv217.seq
 314516388     gbinv2170.se
 297308916     gbinv2171.se
 292968500     gbinv2172.se
 496164735     gbinv2173.se
 481491039     gbinv2174.se
 495265524     gbinv2175.se
 253470716     gbinv2176.se
 458530233     gbinv2177.se
 487608719     gbinv2178.se
 472429782     gbinv2179.se
 499999011     gbinv218.seq
 389636252     gbinv2180.se
 495693435     gbinv2181.se
 392052719     gbinv2182.se
 264437788     gbinv2183.se
 443334489     gbinv2184.se
 230043423     gbinv2185.se
 269964237     gbinv2186.se
 494946146     gbinv2187.se
 494490609     gbinv2188.se
 495398094     gbinv2189.se
 499999910     gbinv219.seq
 469215569     gbinv2190.se
 455146603     gbinv2191.se
 295397747     gbinv2192.se
 488413762     gbinv2193.se
 487035672     gbinv2194.se
 421138557     gbinv2195.se
 480606575     gbinv2196.se
 423180436     gbinv2197.se
 490516344     gbinv2198.se
 528217511     gbinv2199.se
 439600490     gbinv22.seq
 499995944     gbinv220.seq
 521533551     gbinv2200.se
 474679653     gbinv2201.se
 470017923     gbinv2202.se
 463630483     gbinv2203.se
 447022560     gbinv2204.se
 433272140     gbinv2205.se
 403621417     gbinv2206.se
 371161487     gbinv2207.se
 370721975     gbinv2208.se
 350699165     gbinv2209.se
 172686155     gbinv221.seq
 345978572     gbinv2210.se
 334192498     gbinv2211.se
 302363554     gbinv2212.se
 483111071     gbinv2213.se
 370391063     gbinv2214.se
 462747061     gbinv2215.se
 374603467     gbinv2216.se
 371684472     gbinv2217.se
 367702787     gbinv2218.se
 254844076     gbinv2219.se
 499999374     gbinv222.seq
 447028067     gbinv2220.se
 425304745     gbinv2221.se
 333352110     gbinv2222.se
 274400304     gbinv2223.se
 471736787     gbinv2224.se
 490609032     gbinv2225.se
  39963466     gbinv2226.se
 250445442     gbinv2227.se
 340936274     gbinv2228.se
 331290199     gbinv2229.se
 455573372     gbinv223.seq
 459338870     gbinv2230.se
 398156374     gbinv2231.se
 209872305     gbinv2232.se
 493727525     gbinv2233.se
 234053029     gbinv2234.se
 330398798     gbinv2235.se
 322152710     gbinv2236.se
 438520091     gbinv2237.se
 329194366     gbinv2238.se
 259765999     gbinv2239.se
 289058569     gbinv224.seq
 491352505     gbinv2240.se
 495997215     gbinv2241.se
 453638594     gbinv2242.se
 223893231     gbinv2243.se
 462328934     gbinv2244.se
  47937837     gbinv2245.se
 666099951     gbinv2246.se
 608322909     gbinv2247.se
 606999577     gbinv2248.se
 598409357     gbinv2249.se
  54983087     gbinv225.seq
 554616198     gbinv2250.se
 549526793     gbinv2251.se
 543397305     gbinv2252.se
 493234978     gbinv2253.se
 482622307     gbinv2254.se
 441160836     gbinv2255.se
 409120880     gbinv2256.se
 407748242     gbinv2257.se
 401098026     gbinv2258.se
 381292692     gbinv2259.se
  52942591     gbinv226.seq
 492620993     gbinv2260.se
 209061532     gbinv2261.se
 195551873     gbinv2262.se
 483933652     gbinv2263.se
 448922184     gbinv2264.se
 377933642     gbinv2265.se
 353832635     gbinv2266.se
 466186244     gbinv2267.se
 472093739     gbinv2268.se
 302044899     gbinv2269.se
 157076096     gbinv227.seq
 396194374     gbinv2270.se
 378718477     gbinv2271.se
 350612967     gbinv2272.se
 348071696     gbinv2273.se
 342986431     gbinv2274.se
 499133175     gbinv2275.se
 470225049     gbinv2276.se
 435027658     gbinv2277.se
 420532966     gbinv2278.se
 402683464     gbinv2279.se
 499999147     gbinv228.seq
 384540677     gbinv2280.se
 494725877     gbinv2281.se
 453956073     gbinv2282.se
 204295509     gbinv2283.se
 474067646     gbinv2284.se
 476639601     gbinv2285.se
 484933107     gbinv2286.se
 395732392     gbinv2287.se
 438890022     gbinv2288.se
 456308133     gbinv2289.se
 268190266     gbinv229.seq
 470537310     gbinv2290.se
 482209951     gbinv2291.se
 473028372     gbinv2292.se
 423354886     gbinv2293.se
 486387593     gbinv2294.se
 444536472     gbinv2295.se
 338942046     gbinv2296.se
 253372208     gbinv2297.se
 490194682     gbinv2298.se
 397571523     gbinv2299.se
 173964304     gbinv23.seq
 499996088     gbinv230.seq
 160017925     gbinv2300.se
 444526866     gbinv2301.se
 498822648     gbinv2302.se
 878734418     gbinv2303.se
 874599041     gbinv2304.se
 872525000     gbinv2305.se
 810605254     gbinv2306.se
 791733638     gbinv2307.se
 789407437     gbinv2308.se
 782472270     gbinv2309.se
 499997883     gbinv231.seq
 744341862     gbinv2310.se
 734535542     gbinv2311.se
 723265217     gbinv2312.se
 701789494     gbinv2313.se
 634436683     gbinv2314.se
 597991819     gbinv2315.se
 584398302     gbinv2316.se
 575496297     gbinv2317.se
     20247     gbinv2318.se
 481165334     gbinv2319.se
 182060786     gbinv232.seq
 455732808     gbinv2320.se
 485309856     gbinv2321.se
 494513726     gbinv2322.se
 497663773     gbinv2323.se
 382364504     gbinv2324.se
 437913419     gbinv2325.se
 481538424     gbinv2326.se
 246957812     gbinv2327.se
 269453322     gbinv2328.se
 448776283     gbinv2329.se
 499192390     gbinv233.seq
 437794803     gbinv2330.se
 475781424     gbinv2331.se
 486507257     gbinv2332.se
 252424559     gbinv2333.se
 463198906     gbinv2334.se
 484570735     gbinv2335.se
 491262429     gbinv2336.se
 481748685     gbinv2337.se
 439969911     gbinv2338.se
 474681061     gbinv2339.se
 499771354     gbinv234.seq
 496223471     gbinv2340.se
 479327549     gbinv2341.se
 490980575     gbinv2342.se
 401290606     gbinv2343.se
 450069903     gbinv2344.se
 231800070     gbinv2345.se
 466481331     gbinv2346.se
 267102427     gbinv2347.se
 486393703     gbinv2348.se
 493548517     gbinv2349.se
 498733787     gbinv235.seq
  47011992     gbinv2350.se
 477137813     gbinv2351.se
 484635703     gbinv2352.se
 480774927     gbinv2353.se
 383503507     gbinv2354.se
 633887367     gbinv2355.se
 596035677     gbinv2356.se
 453103954     gbinv2357.se
 398773887     gbinv2358.se
 499266023     gbinv2359.se
 135327980     gbinv236.seq
 488559276     gbinv2360.se
 449420963     gbinv2361.se
 244190922     gbinv2362.se
 325251055     gbinv2363.se
 319761877     gbinv2364.se
 303271636     gbinv2365.se
 288442013     gbinv2366.se
 286359699     gbinv2367.se
 274771980     gbinv2368.se
 269362148     gbinv2369.se
 496659695     gbinv237.seq
 269094691     gbinv2370.se
 495661466     gbinv2371.se
 443298652     gbinv2372.se
 434864143     gbinv2373.se
 380857489     gbinv2374.se
 427749408     gbinv2375.se
 482123129     gbinv2376.se
 490392359     gbinv2377.se
 379537415     gbinv2378.se
 359370523     gbinv2379.se
  51960557     gbinv238.seq
 452003097     gbinv2380.se
 424541726     gbinv2381.se
 423152550     gbinv2382.se
 444327089     gbinv2383.se
 499572556     gbinv2384.se
 475369530     gbinv2385.se
 462235675     gbinv2386.se
  90001324     gbinv2387.se
 496650137     gbinv2388.se
 489821547     gbinv2389.se
 466568646     gbinv239.seq
 460822299     gbinv2390.se
 307445643     gbinv2391.se
 380013590     gbinv2392.se
 488931197     gbinv2393.se
 454367081     gbinv2394.se
 349039969     gbinv2395.se
 473031888     gbinv2396.se
 418801674     gbinv2397.se
 498108082     gbinv2398.se
 498120349     gbinv2399.se
 490451259     gbinv24.seq
 479577598     gbinv240.seq
 408929343     gbinv2400.se
 499630119     gbinv2401.se
 384531267     gbinv2402.se
 457310693     gbinv2403.se
 444277320     gbinv2404.se
 471783657     gbinv2405.se
 422890466     gbinv2406.se
 391304772     gbinv2407.se
 477926754     gbinv2408.se
 445795962     gbinv2409.se
 450560394     gbinv241.seq
 151928710     gbinv2410.se
 472706293     gbinv2411.se
 487216638     gbinv2412.se
 253217892     gbinv2413.se
 370579793     gbinv2414.se
 469571875     gbinv2415.se
 130063931     gbinv2416.se
 492341075     gbinv2417.se
 448952174     gbinv2418.se
 494816993     gbinv2419.se
 482003105     gbinv242.seq
 489097379     gbinv2420.se
 380096149     gbinv2421.se
 437128933     gbinv2422.se
 414796835     gbinv2423.se
 485308820     gbinv2424.se
 499863087     gbinv2425.se
 389548539     gbinv2426.se
 483092509     gbinv2427.se
 497796128     gbinv2428.se
 354964088     gbinv2429.se
 121049467     gbinv243.seq
 341517141     gbinv2430.se
 186308430     gbinv2431.se
 455520000     gbinv2432.se
 488591295     gbinv2433.se
 471889620     gbinv2434.se
 468386713     gbinv2435.se
 273137680     gbinv2436.se
 475682267     gbinv2437.se
 489831807     gbinv2438.se
 498258838     gbinv2439.se
 494590358     gbinv244.seq
 435674712     gbinv2440.se
 126649563     gbinv2441.se
 471916306     gbinv2442.se
 419891689     gbinv2443.se
 436853704     gbinv2444.se
 468729750     gbinv2445.se
 258794959     gbinv2446.se
 433858233     gbinv2447.se
 495102250     gbinv2448.se
 472343980     gbinv2449.se
 499153393     gbinv245.seq
 436807814     gbinv2450.se
 497542139     gbinv2451.se
 473743854     gbinv2452.se
 474406895     gbinv2453.se
 488848334     gbinv2454.se
 102391847     gbinv2455.se
 473839183     gbinv2456.se
 492933413     gbinv2457.se
 443134261     gbinv2458.se
 321025551     gbinv2459.se
 499599167     gbinv246.seq
 243584430     gbinv2460.se
 465907063     gbinv2461.se
 381182722     gbinv2462.se
 335529634     gbinv2463.se
 470572982     gbinv2464.se
 482586153     gbinv2465.se
  54239318     gbinv2466.se
 466687468     gbinv2467.se
 463581688     gbinv2468.se
 466345250     gbinv2469.se
 494052759     gbinv247.seq
 461907502     gbinv2470.se
 317778784     gbinv2471.se
 478443992     gbinv2472.se
 292864445     gbinv2473.se
 561078574     gbinv2474.se
 527425233     gbinv2475.se
 480040409     gbinv2476.se
 479973044     gbinv2477.se
 473597004     gbinv2478.se
 469999664     gbinv2479.se
 498084896     gbinv248.seq
 471372098     gbinv2480.se
 481907395     gbinv2481.se
 324814919     gbinv2482.se
 471748432     gbinv2483.se
 362011622     gbinv2484.se
 415540099     gbinv2485.se
 470695666     gbinv2486.se
 491801071     gbinv2487.se
 342413604     gbinv2488.se
 452407188     gbinv2489.se
 493910409     gbinv249.seq
 399752974     gbinv2490.se
 460141586     gbinv2491.se
 465234204     gbinv2492.se
 491366078     gbinv2493.se
 310042236     gbinv2494.se
 443515499     gbinv2495.se
 431455593     gbinv2496.se
 458608098     gbinv2497.se
 489445540     gbinv2498.se
 470672667     gbinv2499.se
 491062414     gbinv25.seq
 305143352     gbinv250.seq
 222134283     gbinv2500.se
 418383435     gbinv2501.se
 489254306     gbinv2502.se
 434277187     gbinv2503.se
 470762853     gbinv2504.se
 289123670     gbinv2505.se
 486602298     gbinv2506.se
 470151895     gbinv2507.se
 378353582     gbinv2508.se
 427559841     gbinv2509.se
 453013224     gbinv251.seq
 485589271     gbinv2510.se
 493053369     gbinv2511.se
 391309323     gbinv2512.se
 468773311     gbinv2513.se
 462352263     gbinv2514.se
 496508959     gbinv2515.se
 484695003     gbinv2516.se
 137180299     gbinv2517.se
 593390575     gbinv2518.se
 598139355     gbinv2519.se
 480839077     gbinv252.seq
 590227411     gbinv2520.se
 586230262     gbinv2521.se
 574374521     gbinv2522.se
 544350211     gbinv2523.se
 521946190     gbinv2524.se
 469461153     gbinv2525.se
 457537023     gbinv2526.se
 374045251     gbinv2527.se
 364819928     gbinv2528.se
 357491398     gbinv2529.se
 375796260     gbinv253.seq
 340643640     gbinv2530.se
 323564724     gbinv2531.se
 499947802     gbinv2532.se
  92123890     gbinv2533.se
 474020597     gbinv2534.se
 480708567     gbinv2535.se
 469367579     gbinv2536.se
 492815571     gbinv2537.se
  92554169     gbinv2538.se
 361765937     gbinv2539.se
 499933702     gbinv254.seq
 465831891     gbinv2540.se
 384175099     gbinv2541.se
 497041728     gbinv2542.se
 453369230     gbinv2543.se
 498008699     gbinv2544.se
 482798657     gbinv2545.se
 124512981     gbinv2546.se
 481399774     gbinv2547.se
 395198134     gbinv2548.se
 423236220     gbinv2549.se
 485464339     gbinv255.seq
 379497414     gbinv2550.se
 498087484     gbinv2551.se
 472511978     gbinv2552.se
 490949512     gbinv2553.se
 483576966     gbinv2554.se
 497131956     gbinv2555.se
 478877128     gbinv2556.se
 488383749     gbinv2557.se
 470901313     gbinv2558.se
 499661934     gbinv2559.se
 485283938     gbinv256.seq
 499999299     gbinv2560.se
 251793675     gbinv2561.se
 498294953     gbinv257.seq
 414580638     gbinv258.seq
 498679440     gbinv259.seq
 470215320     gbinv26.seq
 495007238     gbinv260.seq
 486086193     gbinv261.seq
 483986740     gbinv262.seq
 479016567     gbinv263.seq
 377180280     gbinv264.seq
 491313703     gbinv265.seq
 482991950     gbinv266.seq
 495169229     gbinv267.seq
 493741890     gbinv268.seq
 495500028     gbinv269.seq
 485523455     gbinv27.seq
 371035005     gbinv270.seq
 470293000     gbinv271.seq
 496253081     gbinv272.seq
 496289838     gbinv273.seq
 472378022     gbinv274.seq
 493450323     gbinv275.seq
 418570715     gbinv276.seq
 493158119     gbinv277.seq
 491119641     gbinv278.seq
 465656312     gbinv279.seq
 174159504     gbinv28.seq
 490891118     gbinv280.seq
 459581775     gbinv281.seq
 406078142     gbinv282.seq
 476900813     gbinv283.seq
 481848691     gbinv284.seq
 496747716     gbinv285.seq
 492742204     gbinv286.seq
 496271174     gbinv287.seq
 392139815     gbinv288.seq
 496951694     gbinv289.seq
 486730694     gbinv29.seq
 492317100     gbinv290.seq
 475961856     gbinv291.seq
 498252048     gbinv292.seq
 496664764     gbinv293.seq
 351267284     gbinv294.seq
 454438248     gbinv295.seq
 490109816     gbinv296.seq
 477836082     gbinv297.seq
 497117087     gbinv298.seq
 273421111     gbinv299.seq
 499999452     gbinv3.seq
 495353494     gbinv30.seq
 484550538     gbinv300.seq
 486204454     gbinv301.seq
 489013669     gbinv302.seq
 499892182     gbinv303.seq
 389960712     gbinv304.seq
 230763287     gbinv305.seq
 433765668     gbinv306.seq
 341801067     gbinv307.seq
 488714019     gbinv308.seq
 442231654     gbinv309.seq
 471931517     gbinv31.seq
 498589041     gbinv310.seq
 499230488     gbinv311.seq
 194405414     gbinv312.seq
 499998058     gbinv313.seq
 499998364     gbinv314.seq
 395726273     gbinv315.seq
 499997345     gbinv316.seq
 499998631     gbinv317.seq
 234518794     gbinv318.seq
 499998912     gbinv319.seq
 488287283     gbinv32.seq
 499997675     gbinv320.seq
 289473295     gbinv321.seq
 499998904     gbinv322.seq
 499997765     gbinv323.seq
 395381535     gbinv324.seq
 499998475     gbinv325.seq
 499999467     gbinv326.seq
 499650322     gbinv327.seq
 499858364     gbinv328.seq
 351644014     gbinv329.seq
 494771070     gbinv33.seq
 499999353     gbinv330.seq
 499954513     gbinv331.seq
 394312187     gbinv332.seq
 499998973     gbinv333.seq
 499768151     gbinv334.seq
 499935390     gbinv335.seq
 262394318     gbinv336.seq
 499489044     gbinv337.seq
 499984461     gbinv338.seq
 499999178     gbinv339.seq
 452242161     gbinv34.seq
 219010924     gbinv340.seq
 499665286     gbinv341.seq
 499954794     gbinv342.seq
 499986274     gbinv343.seq
 349517342     gbinv344.seq
 500000137     gbinv345.seq
 499979428     gbinv346.seq
 499843177     gbinv347.seq
 499948105     gbinv348.seq
 500000223     gbinv349.seq
 319197815     gbinv35.seq
  67122505     gbinv350.seq
 499999636     gbinv351.seq
 499704487     gbinv352.seq
 499897338     gbinv353.seq
 499999895     gbinv354.seq
  68002970     gbinv355.seq
 499977958     gbinv356.seq
 499904157     gbinv357.seq
 499970007     gbinv358.seq
 499999529     gbinv359.seq
 305989835     gbinv36.seq
 499940074     gbinv360.seq
 122380920     gbinv361.seq
 500000224     gbinv362.seq
 499999552     gbinv363.seq
 468683478     gbinv364.seq
 499670167     gbinv365.seq
 499934229     gbinv366.seq
 499999149     gbinv367.seq
  90103424     gbinv368.seq
 499998050     gbinv369.seq
 499448339     gbinv37.seq
 499995493     gbinv370.seq
 499995997     gbinv371.seq
 499995585     gbinv372.seq
 499995576     gbinv373.seq
 131711062     gbinv374.seq
 499993745     gbinv375.seq
 499999126     gbinv376.seq
 499999718     gbinv377.seq
  58189022     gbinv378.seq
 500000106     gbinv379.seq
 331575916     gbinv38.seq
 499974743     gbinv380.seq
 497394329     gbinv381.seq
 486067837     gbinv382.seq
  97512248     gbinv383.seq
 481046566     gbinv384.seq
 450037592     gbinv385.seq
 303709120     gbinv386.seq
 293451879     gbinv387.seq
 280090292     gbinv388.seq
 279807655     gbinv389.seq
 409329994     gbinv39.seq
 274554291     gbinv390.seq
 266890013     gbinv391.seq
 491295680     gbinv392.seq
 418047621     gbinv393.seq
 383074342     gbinv394.seq
 489267408     gbinv395.seq
 393039463     gbinv396.seq
 484538449     gbinv397.seq
 482310364     gbinv398.seq
 491415359     gbinv399.seq
 499495330     gbinv4.seq
 337324712     gbinv40.seq
 495004950     gbinv400.seq
 484038821     gbinv401.seq
 495670320     gbinv402.seq
  40846857     gbinv403.seq
 492571202     gbinv404.seq
 490206006     gbinv405.seq
 445709424     gbinv406.seq
 207302902     gbinv407.seq
 370283947     gbinv408.seq
 207800719     gbinv409.seq
 416903973     gbinv41.seq
 403111025     gbinv410.seq
 496966413     gbinv411.seq
 495208718     gbinv412.seq
 486338081     gbinv413.seq
 491887863     gbinv414.seq
  62682558     gbinv415.seq
 487684874     gbinv416.seq
 495915356     gbinv417.seq
 497117994     gbinv418.seq
 485878834     gbinv419.seq
 480341756     gbinv42.seq
 336958408     gbinv420.seq
 470338855     gbinv421.seq
 473857916     gbinv422.seq
 488417194     gbinv423.seq
 472996654     gbinv424.seq
 444602917     gbinv425.seq
 489109149     gbinv426.seq
 489050714     gbinv427.seq
 492905647     gbinv428.seq
 464574397     gbinv429.seq
 470721202     gbinv43.seq
 389650543     gbinv430.seq
 499026362     gbinv431.seq
 459755126     gbinv432.seq
 457336321     gbinv433.seq
 468059538     gbinv434.seq
 487547225     gbinv435.seq
 494629437     gbinv436.seq
 499368968     gbinv437.seq
 425865947     gbinv438.seq
 447703471     gbinv439.seq
 478013763     gbinv44.seq
 471358720     gbinv440.seq
 106488590     gbinv441.seq
 494438067     gbinv442.seq
 499096313     gbinv443.seq
 174717833     gbinv444.seq
 439432672     gbinv445.seq
 315017082     gbinv446.seq
 247279447     gbinv447.seq
 493106968     gbinv448.seq
 482399453     gbinv449.seq
 372275396     gbinv45.seq
 487563600     gbinv450.seq
 495047837     gbinv451.seq
 345419513     gbinv452.seq
 499133273     gbinv453.seq
 496482189     gbinv454.seq
 369581646     gbinv455.seq
 456145557     gbinv456.seq
 200285196     gbinv457.seq
 495154413     gbinv458.seq
 341654330     gbinv459.seq
 473606814     gbinv46.seq
 336683654     gbinv460.seq
 493060580     gbinv461.seq
 107491235     gbinv462.seq
 487938647     gbinv463.seq
 495763325     gbinv464.seq
 481723089     gbinv465.seq
 326171717     gbinv466.seq
 485891711     gbinv467.seq
 492821648     gbinv468.seq
 471307712     gbinv469.seq
 476845411     gbinv47.seq
 311911756     gbinv470.seq
 499380148     gbinv471.seq
 482084817     gbinv472.seq
 479662419     gbinv473.seq
 363343706     gbinv474.seq
 489746713     gbinv475.seq
 499514774     gbinv476.seq
 496438512     gbinv477.seq
 492580334     gbinv478.seq
 486836376     gbinv479.seq
 486980011     gbinv48.seq
 496615730     gbinv480.seq
 482720635     gbinv481.seq
 134241704     gbinv482.seq
 493089306     gbinv483.seq
 490891004     gbinv484.seq
 498098866     gbinv485.seq
 498391590     gbinv486.seq
 493309439     gbinv487.seq
 324291471     gbinv488.seq
 484493924     gbinv489.seq
 160013874     gbinv49.seq
 491069771     gbinv490.seq
 494055574     gbinv491.seq
 235593723     gbinv492.seq
 319983008     gbinv493.seq
 484241023     gbinv494.seq
 216170369     gbinv495.seq
 218804026     gbinv496.seq
 336455655     gbinv497.seq
 297857601     gbinv498.seq
 477593708     gbinv499.seq
 499748536     gbinv5.seq
 493935222     gbinv50.seq
 493171167     gbinv500.seq
  96653657     gbinv501.seq
 401450903     gbinv502.seq
 471214414     gbinv503.seq
 478230772     gbinv504.seq
 481554780     gbinv505.seq
 119372855     gbinv506.seq
 489114034     gbinv507.seq
 418974457     gbinv508.seq
 492119058     gbinv509.seq
 422099764     gbinv51.seq
 488068826     gbinv510.seq
  86400276     gbinv511.seq
 475977385     gbinv512.seq
 479094391     gbinv513.seq
  91925882     gbinv514.seq
 498866242     gbinv515.seq
 475446584     gbinv516.seq
 492109157     gbinv517.seq
 493644048     gbinv518.seq
 450867996     gbinv519.seq
 466237117     gbinv52.seq
 491759493     gbinv520.seq
  84745799     gbinv521.seq
 423732674     gbinv522.seq
 344360076     gbinv523.seq
 487664625     gbinv524.seq
 481798553     gbinv525.seq
 419437573     gbinv526.seq
 447480354     gbinv527.seq
 458542150     gbinv528.seq
  84187054     gbinv529.seq
 490207614     gbinv53.seq
 476248749     gbinv530.seq
 482272438     gbinv531.seq
 498234741     gbinv532.seq
 471043224     gbinv533.seq
 136592520     gbinv534.seq
 495120952     gbinv535.seq
 498047113     gbinv536.seq
 493290837     gbinv537.seq
 467613412     gbinv538.seq
 464868282     gbinv539.seq
 480431708     gbinv54.seq
 485108715     gbinv540.seq
  70627368     gbinv541.seq
 444909488     gbinv542.seq
 457689916     gbinv543.seq
 485382078     gbinv544.seq
 496105931     gbinv545.seq
 484291167     gbinv546.seq
 248438198     gbinv547.seq
 413526177     gbinv548.seq
 438000207     gbinv549.seq
 268718981     gbinv55.seq
 487748206     gbinv550.seq
 497322827     gbinv551.seq
 171187065     gbinv552.seq
 404122148     gbinv553.seq
 358274008     gbinv554.seq
 352555230     gbinv555.seq
 335719715     gbinv556.seq
 334992684     gbinv557.seq
 323934868     gbinv558.seq
 323397124     gbinv559.seq
 391536350     gbinv56.seq
 292340545     gbinv560.seq
 497373639     gbinv561.seq
 451425634     gbinv562.seq
 352564218     gbinv563.seq
 457737190     gbinv564.seq
 480925976     gbinv565.seq
 482363288     gbinv566.seq
 490058774     gbinv567.seq
 457330992     gbinv568.seq
 213313220     gbinv569.seq
 441369502     gbinv57.seq
 475683221     gbinv570.seq
 475722382     gbinv571.seq
 474820474     gbinv572.seq
 463889606     gbinv573.seq
 174479470     gbinv574.seq
 467301426     gbinv575.seq
 487596983     gbinv576.seq
 466523941     gbinv577.seq
 473849332     gbinv578.seq
 271533425     gbinv579.seq
 395604817     gbinv58.seq
 474315468     gbinv580.seq
 422684936     gbinv581.seq
 403437207     gbinv582.seq
 460401414     gbinv583.seq
 495684114     gbinv584.seq
 496931437     gbinv585.seq
 255707629     gbinv586.seq
 488417645     gbinv587.seq
 493391118     gbinv588.seq
 430721640     gbinv589.seq
 484951437     gbinv59.seq
 483962961     gbinv590.seq
 482614063     gbinv591.seq
 466924368     gbinv592.seq
 153705523     gbinv593.seq
 469807657     gbinv594.seq
 497173372     gbinv595.seq
 486068129     gbinv596.seq
 497761269     gbinv597.seq
 483774021     gbinv598.seq
 208975227     gbinv599.seq
 371668925     gbinv6.seq
 431159123     gbinv60.seq
 482561048     gbinv600.seq
 489387386     gbinv601.seq
 174750473     gbinv602.seq
 520668510     gbinv603.seq
 439679373     gbinv604.seq
  76608705     gbinv605.seq
 544459581     gbinv606.seq
 291577990     gbinv607.seq
 499183813     gbinv608.seq
 449457434     gbinv609.seq
 449767967     gbinv61.seq
 403099826     gbinv610.seq
 426341523     gbinv611.seq
 452289588     gbinv612.seq
 332054885     gbinv613.seq
 216067261     gbinv614.seq
 363589773     gbinv615.seq
 349108604     gbinv616.seq
 466080734     gbinv617.seq
 433540835     gbinv618.seq
 325349387     gbinv619.seq
 494181807     gbinv62.seq
 414135977     gbinv620.seq
 443362325     gbinv621.seq
 458656169     gbinv622.seq
 469667434     gbinv623.seq
 275644987     gbinv624.seq
 446552014     gbinv625.seq
 480169917     gbinv626.seq
 474041236     gbinv627.seq
 439739785     gbinv628.seq
 415879695     gbinv629.seq
 497557396     gbinv63.seq
 467640439     gbinv630.seq
 312202563     gbinv631.seq
 476756795     gbinv632.seq
 477061626     gbinv633.seq
 483683490     gbinv634.seq
 495487713     gbinv635.seq
  69234679     gbinv636.seq
 477792636     gbinv637.seq
 492728468     gbinv638.seq
 425135691     gbinv639.seq
 409223006     gbinv64.seq
 353041445     gbinv640.seq
 470334960     gbinv641.seq
 494601058     gbinv642.seq
 481221711     gbinv643.seq
 396473476     gbinv644.seq
 483642314     gbinv645.seq
 482127664     gbinv646.seq
 470874419     gbinv647.seq
 495029689     gbinv648.seq
  99066263     gbinv649.seq
 432405101     gbinv65.seq
 477955845     gbinv650.seq
 452660426     gbinv651.seq
 467009813     gbinv652.seq
 409211575     gbinv653.seq
 281441527     gbinv654.seq
 321243822     gbinv655.seq
 272762615     gbinv656.seq
 459220600     gbinv657.seq
 380210496     gbinv658.seq
 157861358     gbinv659.seq
 302298162     gbinv66.seq
 496825048     gbinv660.seq
 457058797     gbinv661.seq
 475749694     gbinv662.seq
 458940745     gbinv663.seq
 478290025     gbinv664.seq
 201201186     gbinv665.seq
 476458619     gbinv666.seq
 472367844     gbinv667.seq
 491956509     gbinv668.seq
 445112980     gbinv669.seq
 474204665     gbinv67.seq
 478727516     gbinv670.seq
 213103145     gbinv671.seq
 426002690     gbinv672.seq
 491306551     gbinv673.seq
 485922068     gbinv674.seq
 470775025     gbinv675.seq
 259886474     gbinv676.seq
 323358243     gbinv677.seq
 292361181     gbinv678.seq
 472027339     gbinv679.seq
 499406905     gbinv68.seq
 394618639     gbinv680.seq
 498685113     gbinv681.seq
 252840705     gbinv682.seq
 409818882     gbinv683.seq
 483153574     gbinv684.seq
 356373819     gbinv685.seq
 382117771     gbinv686.seq
 414986838     gbinv687.seq
 358562967     gbinv688.seq
 454612949     gbinv689.seq
 493280432     gbinv69.seq
 397094236     gbinv690.seq
 472022816     gbinv691.seq
 375604154     gbinv692.seq
 260058125     gbinv693.seq
 416870448     gbinv694.seq
 337551656     gbinv695.seq
 323476118     gbinv696.seq
 316192878     gbinv697.seq
 483033075     gbinv698.seq
 484553056     gbinv699.seq
 462608484     gbinv7.seq
 319188821     gbinv70.seq
 485400895     gbinv700.seq
 444237062     gbinv701.seq
 115137081     gbinv702.seq
 465061268     gbinv703.seq
 450665417     gbinv704.seq
 495339385     gbinv705.seq
 358679242     gbinv706.seq
 488909847     gbinv707.seq
 494569731     gbinv708.seq
 446419168     gbinv709.seq
 491655073     gbinv71.seq
 393089050     gbinv710.seq
 119924885     gbinv711.seq
 475723349     gbinv712.seq
 418498253     gbinv713.seq
 487729463     gbinv714.seq
 442064966     gbinv715.seq
 459399034     gbinv716.seq
 476019529     gbinv717.seq
 489445959     gbinv718.seq
 488427181     gbinv719.seq
 492219703     gbinv72.seq
  39113487     gbinv720.seq
 478318630     gbinv721.seq
 485192704     gbinv722.seq
 487924132     gbinv723.seq
 367187723     gbinv724.seq
 491253033     gbinv725.seq
 492099884     gbinv726.seq
 492318782     gbinv727.seq
 490488560     gbinv728.seq
 264709414     gbinv729.seq
 480268373     gbinv73.seq
 498243322     gbinv730.seq
 461893097     gbinv731.seq
 479536374     gbinv732.seq
 498214872     gbinv733.seq
 358503530     gbinv734.seq
 497880059     gbinv735.seq
 328840422     gbinv736.seq
 388768319     gbinv737.seq
 497514162     gbinv738.seq
 102760609     gbinv739.seq
 421068648     gbinv74.seq
 424365480     gbinv740.seq
 415464839     gbinv741.seq
 468645236     gbinv742.seq
 491418312     gbinv743.seq
 422461178     gbinv744.seq
 494059900     gbinv745.seq
 492105201     gbinv746.seq
 371680457     gbinv747.seq
 418666111     gbinv748.seq
 385203223     gbinv749.seq
 498478577     gbinv75.seq
 490161407     gbinv750.seq
 462283913     gbinv751.seq
 497343220     gbinv752.seq
 483358775     gbinv753.seq
 419495810     gbinv754.seq
 495088992     gbinv755.seq
 118039128     gbinv756.seq
 460760613     gbinv757.seq
 474795905     gbinv758.seq
 448271770     gbinv759.seq
 489123698     gbinv76.seq
 447953092     gbinv760.seq
 397698504     gbinv761.seq
 412906977     gbinv762.seq
 414039055     gbinv763.seq
 373499990     gbinv764.seq
 352095009     gbinv765.seq
 171624580     gbinv766.seq
 492880950     gbinv767.seq
 496329611     gbinv768.seq
 495293458     gbinv769.seq
 498905574     gbinv77.seq
 326435281     gbinv770.seq
 478875133     gbinv771.seq
 438224962     gbinv772.seq
 474184048     gbinv773.seq
 357686295     gbinv774.seq
 465465282     gbinv775.seq
 485209832     gbinv776.seq
 427730310     gbinv777.seq
 361113223     gbinv778.seq
 482159714     gbinv779.seq
 234808936     gbinv78.seq
 495382944     gbinv780.seq
 299589099     gbinv781.seq
 321246481     gbinv782.seq
 309309582     gbinv783.seq
 488604754     gbinv784.seq
 410235494     gbinv785.seq
 495922375     gbinv786.seq
 434632204     gbinv787.seq
  74348655     gbinv788.seq
 541537247     gbinv789.seq
 466465897     gbinv79.seq
 355690685     gbinv790.seq
 292909846     gbinv791.seq
 463584322     gbinv792.seq
 387676008     gbinv793.seq
 372674865     gbinv794.seq
 485847387     gbinv795.seq
 484407673     gbinv796.seq
 473708314     gbinv797.seq
 352986490     gbinv798.seq
 443627527     gbinv799.seq
 446653334     gbinv8.seq
 473206517     gbinv80.seq
 434076487     gbinv800.seq
 478667921     gbinv801.seq
 488478103     gbinv802.seq
 306326401     gbinv803.seq
 385565833     gbinv804.seq
 482190195     gbinv805.seq
 137160705     gbinv806.seq
 490300743     gbinv807.seq
 419187067     gbinv808.seq
 398652960     gbinv809.seq
 478992009     gbinv81.seq
 436288257     gbinv810.seq
 493888501     gbinv811.seq
 447343866     gbinv812.seq
 496950073     gbinv813.seq
  68378185     gbinv814.seq
 484369453     gbinv815.seq
 474926486     gbinv816.seq
 480605871     gbinv817.seq
 489403870     gbinv818.seq
 489850852     gbinv819.seq
 282038790     gbinv82.seq
 483923401     gbinv820.seq
 195051546     gbinv821.seq
 278317571     gbinv822.seq
 405202233     gbinv823.seq
 481613416     gbinv824.seq
 483053144     gbinv825.seq
 140617338     gbinv826.seq
 480377160     gbinv827.seq
 499100085     gbinv828.seq
 495490578     gbinv829.seq
 478991943     gbinv83.seq
 401267230     gbinv830.seq
 334138952     gbinv831.seq
 475047240     gbinv832.seq
 428648405     gbinv833.seq
 378490165     gbinv834.seq
 487837824     gbinv835.seq
 491255029     gbinv836.seq
 375538343     gbinv837.seq
 353621722     gbinv838.seq
 408852378     gbinv839.seq
 483677905     gbinv84.seq
 494054422     gbinv840.seq
 437725967     gbinv841.seq
 364183673     gbinv842.seq
 466430597     gbinv843.seq
 418516710     gbinv844.seq
 347070086     gbinv845.seq
 481701036     gbinv846.seq
 453274315     gbinv847.seq
 496564297     gbinv848.seq
 467957545     gbinv849.seq
 483677903     gbinv85.seq
 479873706     gbinv850.seq
 479944057     gbinv851.seq
 154655407     gbinv852.seq
 464570217     gbinv853.seq
 498348538     gbinv854.seq
 474586953     gbinv855.seq
 481881129     gbinv856.seq
 132360635     gbinv857.seq
 377651382     gbinv858.seq
 471908759     gbinv859.seq
 309424683     gbinv86.seq
 346087536     gbinv860.seq
 221434064     gbinv861.seq
 312336498     gbinv862.seq
 482097150     gbinv863.seq
 426274349     gbinv864.seq
 491798282     gbinv865.seq
 456244166     gbinv866.seq
 498886557     gbinv867.seq
 413523689     gbinv868.seq
 494612233     gbinv869.seq
 483677981     gbinv87.seq
 269134738     gbinv870.seq
 458119773     gbinv871.seq
 492920478     gbinv872.seq
 331278911     gbinv873.seq
 237876308     gbinv874.seq
 380568436     gbinv875.seq
 323208797     gbinv876.seq
 298483269     gbinv877.seq
 296444100     gbinv878.seq
 461753371     gbinv879.seq
 483678137     gbinv88.seq
  66028693     gbinv880.seq
 499911575     gbinv881.seq
 471640101     gbinv882.seq
 447745268     gbinv883.seq
 441848406     gbinv884.seq
 180180054     gbinv885.seq
 470673663     gbinv886.seq
 492818173     gbinv887.seq
 498278063     gbinv888.seq
 445601713     gbinv889.seq
 478992326     gbinv89.seq
 469989934     gbinv890.seq
 478205479     gbinv891.seq
 459587666     gbinv892.seq
 272670030     gbinv893.seq
 227990903     gbinv894.seq
 413244998     gbinv895.seq
 498213748     gbinv896.seq
 449979801     gbinv897.seq
 461330907     gbinv898.seq
 294874575     gbinv899.seq
 485749846     gbinv9.seq
 271721852     gbinv90.seq
 405670616     gbinv900.seq
 474471565     gbinv901.seq
 439625427     gbinv902.seq
 463229555     gbinv903.seq
 464851338     gbinv904.seq
 455511857     gbinv905.seq
 439389009     gbinv906.seq
 405283735     gbinv907.seq
 419761690     gbinv908.seq
 406996610     gbinv909.seq
 473206806     gbinv91.seq
 442305653     gbinv910.seq
 479961209     gbinv911.seq
 282852446     gbinv912.seq
 494971745     gbinv913.seq
 459071349     gbinv914.seq
 457510304     gbinv915.seq
 482562593     gbinv916.seq
 413357535     gbinv917.seq
 381806397     gbinv918.seq
 357962786     gbinv919.seq
 476783192     gbinv92.seq
 482830686     gbinv920.seq
 494826362     gbinv921.seq
 370208813     gbinv922.seq
 428586963     gbinv923.seq
 123105615     gbinv924.seq
 423910707     gbinv925.seq
 460666534     gbinv926.seq
 432539703     gbinv927.seq
 384196500     gbinv928.seq
 348330627     gbinv929.seq
 479030351     gbinv93.seq
 449196792     gbinv930.seq
 388541575     gbinv931.seq
 386427271     gbinv932.seq
 495791066     gbinv933.seq
 479478002     gbinv934.seq
  80923082     gbinv935.seq
 468644389     gbinv936.seq
 487921921     gbinv937.seq
 470328373     gbinv938.seq
 468642645     gbinv939.seq
 309386799     gbinv94.seq
 411136544     gbinv940.seq
 462696619     gbinv941.seq
 493415138     gbinv942.seq
 499955696     gbinv943.seq
 484026075     gbinv944.seq
 483632078     gbinv945.seq
 496808153     gbinv946.seq
 162547431     gbinv947.seq
 455355382     gbinv948.seq
 452744560     gbinv949.seq
 477840597     gbinv95.seq
 457356752     gbinv950.seq
 492140801     gbinv951.seq
 477236440     gbinv952.seq
 440746130     gbinv953.seq
 201920044     gbinv954.seq
 351798642     gbinv955.seq
 407318285     gbinv956.seq
 497577312     gbinv957.seq
 297816794     gbinv958.seq
 465053752     gbinv959.seq
 487392428     gbinv96.seq
 477543055     gbinv960.seq
 488522642     gbinv961.seq
 485383082     gbinv962.seq
 494197670     gbinv963.seq
 492976606     gbinv964.seq
 491252062     gbinv965.seq
 485879488     gbinv966.seq
 184862936     gbinv967.seq
 490499065     gbinv968.seq
 473434617     gbinv969.seq
 489703622     gbinv97.seq
 491357576     gbinv970.seq
 482466282     gbinv971.seq
 488062265     gbinv972.seq
 207127102     gbinv973.seq
 483701457     gbinv974.seq
 474847426     gbinv975.seq
 392959411     gbinv976.seq
 283167653     gbinv977.seq
 394326806     gbinv978.seq
 386741280     gbinv979.seq
 276099327     gbinv98.seq
 148537239     gbinv980.seq
 412230439     gbinv981.seq
 434620162     gbinv982.seq
 494101468     gbinv983.seq
 494548234     gbinv984.seq
 436233527     gbinv985.seq
 493245062     gbinv986.seq
 474858921     gbinv987.seq
  85346444     gbinv988.seq
 449524998     gbinv989.seq
 494542524     gbinv99.seq
 387985633     gbinv990.seq
 480105396     gbinv991.seq
 468490343     gbinv992.seq
  33888816     gbinv993.seq
 316525209     gbinv994.seq
 491028997     gbinv995.seq
 492549691     gbinv996.seq
 490858334     gbinv997.seq
 480371330     gbinv998.seq
 485115876     gbinv999.seq
 499998697     gbmam1.seq
  82829445     gbmam10.seq
 456214450     gbmam100.seq
 486132453     gbmam101.seq
 483844712     gbmam102.seq
 437064425     gbmam103.seq
 223540742     gbmam104.seq
 451994163     gbmam105.seq
 449442494     gbmam106.seq
 428332658     gbmam107.seq
 499999502     gbmam108.seq
 499980805     gbmam109.seq
  71289242     gbmam11.seq
 304593851     gbmam110.seq
 227944315     gbmam111.seq
 348089742     gbmam112.seq
 373183698     gbmam113.seq
 467160879     gbmam114.seq
 457054238     gbmam115.seq
 483676806     gbmam116.seq
 409916232     gbmam117.seq
 398303012     gbmam118.seq
 346344510     gbmam119.seq
  22560541     gbmam12.seq
 274828989     gbmam120.seq
 266926791     gbmam121.seq
 442156622     gbmam122.seq
 394957817     gbmam123.seq
 359859430     gbmam124.seq
 441833973     gbmam125.seq
 467878018     gbmam126.seq
 460914273     gbmam127.seq
  77886542     gbmam128.seq
 384335011     gbmam129.seq
   1268288     gbmam13.seq
 490312196     gbmam130.seq
 385325611     gbmam131.seq
 473911567     gbmam132.seq
 413152711     gbmam133.seq
 479361008     gbmam134.seq
 435411678     gbmam135.seq
 197832427     gbmam136.seq
 374823133     gbmam137.seq
 463547765     gbmam138.seq
 439985383     gbmam139.seq
 378312043     gbmam14.seq
 408172038     gbmam140.seq
 432812311     gbmam141.seq
 459597410     gbmam142.seq
 495156885     gbmam143.seq
 327564081     gbmam144.seq
 422791489     gbmam145.seq
 491401632     gbmam146.seq
 449317136     gbmam147.seq
 287465618     gbmam148.seq
 394362643     gbmam149.seq
 338653928     gbmam15.seq
 439407312     gbmam150.seq
 453590059     gbmam151.seq
 469351291     gbmam152.seq
  67527610     gbmam153.seq
 483520870     gbmam154.seq
 480679033     gbmam155.seq
 410124870     gbmam156.seq
 460089444     gbmam157.seq
 273447476     gbmam158.seq
 472899893     gbmam159.seq
 477859984     gbmam16.seq
 469419756     gbmam160.seq
 290267902     gbmam161.seq
 453331085     gbmam162.seq
 187958881     gbmam163.seq
 352138940     gbmam164.seq
 440262201     gbmam165.seq
 401683994     gbmam166.seq
 455777749     gbmam167.seq
 465167960     gbmam168.seq
  44571261     gbmam169.seq
 445458565     gbmam17.seq
 449685039     gbmam170.seq
 404827665     gbmam171.seq
 447228326     gbmam172.seq
 494282867     gbmam173.seq
 425898549     gbmam174.seq
 165392109     gbmam175.seq
 457263770     gbmam176.seq
 324046918     gbmam177.seq
 339102216     gbmam178.seq
 323096334     gbmam179.seq
 122412952     gbmam18.seq
 358506878     gbmam180.seq
 422099488     gbmam181.seq
 440058971     gbmam182.seq
 394948573     gbmam183.seq
 469038481     gbmam184.seq
 465364880     gbmam185.seq
 477461411     gbmam186.seq
 236798673     gbmam187.seq
 269398733     gbmam188.seq
 253603154     gbmam189.seq
 451114191     gbmam19.seq
 381680709     gbmam190.seq
 259094846     gbmam191.seq
 433914327     gbmam192.seq
 473689213     gbmam193.seq
 499762686     gbmam194.seq
 225944987     gbmam195.seq
 402292620     gbmam196.seq
 484267156     gbmam197.seq
 422021843     gbmam198.seq
 490305734     gbmam199.seq
 399299008     gbmam2.seq
 418062936     gbmam20.seq
 112546871     gbmam200.seq
 497927921     gbmam201.seq
 377275105     gbmam202.seq
 468953574     gbmam203.seq
 375382417     gbmam204.seq
 479246766     gbmam205.seq
 432957019     gbmam206.seq
 493590582     gbmam207.seq
 329856862     gbmam208.seq
 320418665     gbmam209.seq
 499818179     gbmam21.seq
 267180870     gbmam210.seq
 494229345     gbmam211.seq
 467852307     gbmam212.seq
 169801131     gbmam213.seq
 484790256     gbmam214.seq
 441563731     gbmam215.seq
 488307435     gbmam216.seq
 465828461     gbmam217.seq
 440072400     gbmam218.seq
 498165380     gbmam219.seq
 462376348     gbmam22.seq
 417880520     gbmam220.seq
 476061385     gbmam221.seq
 168979186     gbmam222.seq
 481542732     gbmam223.seq
 477958396     gbmam224.seq
 356503297     gbmam225.seq
 452219504     gbmam226.seq
 373237938     gbmam227.seq
 474361951     gbmam228.seq
 407382471     gbmam229.seq
 370510647     gbmam23.seq
 471880001     gbmam230.seq
 499955615     gbmam231.seq
 446124674     gbmam232.seq
 428305446     gbmam233.seq
 406513882     gbmam234.seq
 496219854     gbmam235.seq
 493963774     gbmam236.seq
 438934094     gbmam237.seq
 296563085     gbmam238.seq
 281941182     gbmam239.seq
 446296416     gbmam24.seq
 456589692     gbmam240.seq
 418783593     gbmam241.seq
 463645501     gbmam242.seq
 439299057     gbmam243.seq
 305561734     gbmam244.seq
 315163717     gbmam245.seq
 291683593     gbmam246.seq
 288961940     gbmam247.seq
 480494424     gbmam248.seq
 453137211     gbmam249.seq
 431104435     gbmam25.seq
 421005676     gbmam250.seq
 485358028     gbmam251.seq
 238286100     gbmam252.seq
 443551588     gbmam253.seq
 363178461     gbmam254.seq
 451506905     gbmam255.seq
 400618499     gbmam256.seq
 471189051     gbmam257.seq
 498164186     gbmam258.seq
 127842067     gbmam259.seq
 480602942     gbmam26.seq
 275430940     gbmam260.seq
 261153012     gbmam261.seq
 490824593     gbmam262.seq
 398633269     gbmam263.seq
 365676919     gbmam264.seq
 478729236     gbmam265.seq
 136938945     gbmam266.seq
 442775382     gbmam267.seq
 235769955     gbmam268.seq
 271434665     gbmam269.seq
 479109855     gbmam27.seq
 255381351     gbmam270.seq
 380492415     gbmam271.seq
 462311017     gbmam272.seq
 435911029     gbmam273.seq
 391212544     gbmam274.seq
 408481718     gbmam275.seq
 490517627     gbmam276.seq
 474372493     gbmam277.seq
 459939019     gbmam278.seq
 375274643     gbmam279.seq
 483903273     gbmam28.seq
 433175275     gbmam280.seq
 383169794     gbmam281.seq
 310638549     gbmam282.seq
 391024231     gbmam283.seq
 360292288     gbmam284.seq
 302202861     gbmam285.seq
 493123811     gbmam286.seq
 468440092     gbmam287.seq
 420650184     gbmam288.seq
 490687199     gbmam289.seq
 483307002     gbmam29.seq
 307564779     gbmam290.seq
 426556076     gbmam291.seq
 499921008     gbmam292.seq
 427976025     gbmam293.seq
 452148077     gbmam294.seq
 470095868     gbmam295.seq
 486475037     gbmam296.seq
 256030582     gbmam297.seq
 254978306     gbmam298.seq
 485347432     gbmam299.seq
 400559326     gbmam3.seq
  48405032     gbmam30.seq
 463299961     gbmam300.seq
 456738587     gbmam301.seq
 188477877     gbmam302.seq
 462441807     gbmam303.seq
 405696374     gbmam304.seq
 488280354     gbmam305.seq
 420230809     gbmam306.seq
 493008404     gbmam307.seq
 435046974     gbmam308.seq
 300504156     gbmam309.seq
 363174382     gbmam31.seq
 362062984     gbmam310.seq
 358513709     gbmam311.seq
 344701574     gbmam312.seq
 407360163     gbmam313.seq
 429342664     gbmam314.seq
 451585500     gbmam315.seq
 444391476     gbmam316.seq
 298415105     gbmam317.seq
 363275258     gbmam318.seq
 446597279     gbmam319.seq
 437246747     gbmam32.seq
 484756334     gbmam320.seq
 398110276     gbmam321.seq
 449893723     gbmam322.seq
 473241966     gbmam323.seq
 389817591     gbmam324.seq
 161500863     gbmam325.seq
 351809027     gbmam326.seq
 349307503     gbmam327.seq
 452057460     gbmam328.seq
 414881705     gbmam329.seq
 470828962     gbmam33.seq
 474005078     gbmam330.seq
 310825393     gbmam331.seq
 431472150     gbmam332.seq
 464576323     gbmam333.seq
 459778718     gbmam334.seq
 423061691     gbmam335.seq
 480371902     gbmam336.seq
 109233524     gbmam337.seq
 438623950     gbmam338.seq
 496035115     gbmam339.seq
 402408906     gbmam34.seq
 448221833     gbmam340.seq
 347762434     gbmam341.seq
 392469439     gbmam342.seq
 296151020     gbmam343.seq
 493933290     gbmam344.seq
 406976198     gbmam345.seq
 469463396     gbmam346.seq
 479692863     gbmam347.seq
 403970308     gbmam348.seq
 199508745     gbmam349.seq
 304109928     gbmam35.seq
 452443739     gbmam36.seq
 451303958     gbmam37.seq
 495648598     gbmam38.seq
 405636626     gbmam39.seq
 477148353     gbmam4.seq
 410457734     gbmam40.seq
 441553748     gbmam41.seq
 367146984     gbmam42.seq
 478421809     gbmam43.seq
 316388332     gbmam44.seq
 352226884     gbmam45.seq
 195247700     gbmam46.seq
 474022452     gbmam47.seq
 378020853     gbmam48.seq
 450136561     gbmam49.seq
 374653134     gbmam5.seq
 450750944     gbmam50.seq
 468132660     gbmam51.seq
 492835688     gbmam52.seq
  75338832     gbmam53.seq
  33997165     gbmam54.seq
   9943400     gbmam55.seq
  43988539     gbmam56.seq
  91321391     gbmam57.seq
  88809559     gbmam58.seq
   6366431     gbmam59.seq
 487713568     gbmam6.seq
  21008026     gbmam60.seq
 449562085     gbmam61.seq
 423620797     gbmam62.seq
 453840584     gbmam63.seq
 491149506     gbmam64.seq
 425479852     gbmam65.seq
 461110029     gbmam66.seq
 385606603     gbmam67.seq
 489901313     gbmam68.seq
 499997715     gbmam69.seq
 401181424     gbmam7.seq
 499995027     gbmam70.seq
  27620586     gbmam71.seq
 907465328     gbmam72.seq
 839494897     gbmam73.seq
 774395849     gbmam74.seq
 588873740     gbmam75.seq
 364960392     gbmam76.seq
 428298067     gbmam77.seq
 283039909     gbmam78.seq
 266822134     gbmam79.seq
 435129139     gbmam8.seq
 255007062     gbmam80.seq
 250435267     gbmam81.seq
 405637168     gbmam82.seq
 372091530     gbmam83.seq
 465555642     gbmam84.seq
 444923834     gbmam85.seq
 341582221     gbmam86.seq
 257946240     gbmam87.seq
 485829704     gbmam88.seq
 486026993     gbmam89.seq
 275779576     gbmam9.seq
 483298905     gbmam90.seq
 494677523     gbmam91.seq
 335874920     gbmam92.seq
 464872853     gbmam93.seq
 468294587     gbmam94.seq
 497569809     gbmam95.seq
 377746247     gbmam96.seq
 460747191     gbmam97.seq
 150130543     gbmam98.seq
 416665240     gbmam99.seq
  30023287     gbnew.txt
 499999427     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335512855     gbpat107.seq
 499999284     gbpat108.seq
 500000022     gbpat109.seq
 499998031     gbpat11.seq
 210521873     gbpat110.seq
 499927571     gbpat111.seq
 499996795     gbpat112.seq
 174127807     gbpat113.seq
 499999957     gbpat114.seq
 499998505     gbpat115.seq
 499996232     gbpat116.seq
   8746372     gbpat117.seq
 499743640     gbpat118.seq
 382829482     gbpat119.seq
 179029144     gbpat12.seq
 499998955     gbpat120.seq
 499998461     gbpat121.seq
 499992686     gbpat122.seq
 499998883     gbpat123.seq
  56645800     gbpat124.seq
 499990147     gbpat125.seq
 499999398     gbpat126.seq
 208443590     gbpat127.seq
 500000173     gbpat128.seq
 499999406     gbpat129.seq
 499957808     gbpat13.seq
  59355952     gbpat130.seq
 499999983     gbpat131.seq
 499998258     gbpat132.seq
 488850944     gbpat133.seq
 499999917     gbpat134.seq
 499998978     gbpat135.seq
  28285714     gbpat136.seq
 499997835     gbpat137.seq
 385160778     gbpat138.seq
 499999463     gbpat139.seq
 499999358     gbpat14.seq
 500000185     gbpat140.seq
 148512991     gbpat141.seq
 499996284     gbpat142.seq
 314551576     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499979680     gbpat148.seq
 125987771     gbpat149.seq
  62760587     gbpat15.seq
 499989559     gbpat150.seq
 499995316     gbpat151.seq
 499998971     gbpat152.seq
 499997529     gbpat153.seq
 169880503     gbpat154.seq
 499999008     gbpat155.seq
 426352200     gbpat156.seq
 499998947     gbpat157.seq
 500000265     gbpat158.seq
 499929307     gbpat159.seq
 499998252     gbpat16.seq
 353565130     gbpat160.seq
 499999580     gbpat161.seq
 499999590     gbpat162.seq
 291237409     gbpat163.seq
 499999083     gbpat164.seq
 499999384     gbpat165.seq
 499999241     gbpat166.seq
 102920253     gbpat167.seq
 499989522     gbpat168.seq
 499993882     gbpat169.seq
 499998663     gbpat17.seq
 499993951     gbpat170.seq
 499999217     gbpat171.seq
 301725661     gbpat172.seq
 499999491     gbpat173.seq
 500000144     gbpat174.seq
 499998806     gbpat175.seq
 319783012     gbpat176.seq
 499603284     gbpat177.seq
 499999184     gbpat178.seq
 499999721     gbpat179.seq
 422099042     gbpat18.seq
  13395273     gbpat180.seq
 497266519     gbpat181.seq
 499999234     gbpat182.seq
 499998806     gbpat183.seq
  86838131     gbpat184.seq
 499934148     gbpat185.seq
 499999973     gbpat186.seq
 499998197     gbpat187.seq
  39745949     gbpat188.seq
 499283147     gbpat189.seq
 499904776     gbpat19.seq
 499998170     gbpat190.seq
 499999623     gbpat191.seq
 499999456     gbpat192.seq
  96585560     gbpat193.seq
 499884333     gbpat194.seq
 499997561     gbpat195.seq
 499999338     gbpat196.seq
 499999860     gbpat197.seq
  90169392     gbpat198.seq
 499993286     gbpat199.seq
 499999607     gbpat2.seq
 499998676     gbpat20.seq
 499994277     gbpat200.seq
 499998512     gbpat201.seq
 499999301     gbpat202.seq
   4092526     gbpat203.seq
 499999756     gbpat204.seq
 499999459     gbpat205.seq
 500000244     gbpat206.seq
 478202129     gbpat207.seq
 500000054     gbpat208.seq
 499999577     gbpat209.seq
 499996070     gbpat21.seq
 321705067     gbpat210.seq
 499991396     gbpat211.seq
 499963719     gbpat212.seq
 350635988     gbpat213.seq
 497506292     gbpat214.seq
 499869540     gbpat215.seq
 421452571     gbpat216.seq
 499425936     gbpat217.seq
 499999361     gbpat218.seq
 336263474     gbpat219.seq
 347874599     gbpat22.seq
 499998549     gbpat220.seq
 499999453     gbpat221.seq
 499999941     gbpat222.seq
 361443812     gbpat223.seq
 499999662     gbpat224.seq
 494515367     gbpat225.seq
 341868206     gbpat226.seq
 499999744     gbpat227.seq
 500000159     gbpat228.seq
 366896749     gbpat229.seq
 499884764     gbpat23.seq
 499999946     gbpat230.seq
 499335751     gbpat231.seq
 389256092     gbpat232.seq
 499996721     gbpat233.seq
 500000056     gbpat234.seq
 498671374     gbpat235.seq
 499998420     gbpat236.seq
 499998793     gbpat237.seq
  21956630     gbpat238.seq
 499999486     gbpat239.seq
 499998615     gbpat24.seq
 499999238     gbpat240.seq
 499998695     gbpat241.seq
 499999401     gbpat242.seq
 488127386     gbpat243.seq
 499999639     gbpat244.seq
 499995447     gbpat245.seq
 499999277     gbpat246.seq
 187738330     gbpat247.seq
 500000259     gbpat248.seq
 499999191     gbpat249.seq
 499663440     gbpat25.seq
 481547581     gbpat250.seq
 495284053     gbpat251.seq
 500000161     gbpat252.seq
 389872169     gbpat253.seq
 499735576     gbpat254.seq
 499999196     gbpat255.seq
 435395590     gbpat256.seq
 499999403     gbpat257.seq
 499998922     gbpat258.seq
 107872018     gbpat259.seq
 499999702     gbpat26.seq
 500000076     gbpat260.seq
 500000151     gbpat261.seq
 163545570     gbpat262.seq
 500000110     gbpat263.seq
 498100835     gbpat264.seq
 415803653     gbpat265.seq
 499996941     gbpat266.seq
 499967401     gbpat267.seq
 499989737     gbpat268.seq
 256724619     gbpat269.seq
 166815595     gbpat27.seq
 499998387     gbpat28.seq
 500000116     gbpat29.seq
  61247109     gbpat3.seq
 213213665     gbpat30.seq
 499999775     gbpat31.seq
 406040813     gbpat32.seq
 499995159     gbpat33.seq
 499999040     gbpat34.seq
 126631564     gbpat35.seq
 499998921     gbpat36.seq
 499998229     gbpat37.seq
 499999652     gbpat38.seq
 140161176     gbpat39.seq
 499999549     gbpat4.seq
 499998950     gbpat40.seq
 493992256     gbpat41.seq
 494767610     gbpat42.seq
 500000227     gbpat43.seq
 149227782     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499998576     gbpat47.seq
  87882658     gbpat48.seq
 499999340     gbpat49.seq
 499999606     gbpat5.seq
 500000057     gbpat50.seq
 499998939     gbpat51.seq
 130970228     gbpat52.seq
 499999975     gbpat53.seq
 499999084     gbpat54.seq
 185010162     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 419098828     gbpat6.seq
 499638184     gbpat60.seq
 429858746     gbpat61.seq
 499999385     gbpat62.seq
 321466580     gbpat63.seq
 499999289     gbpat64.seq
 500000065     gbpat65.seq
 306477406     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999566     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499996100     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474766116     gbpat82.seq
 500000048     gbpat83.seq
 331725818     gbpat84.seq
 499994985     gbpat85.seq
 312350353     gbpat86.seq
 499996281     gbpat87.seq
 499999395     gbpat88.seq
 499999645     gbpat89.seq
 317330927     gbpat9.seq
 205655503     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499984753     gbpat93.seq
 252316670     gbpat94.seq
 499999166     gbpat95.seq
 499997646     gbpat96.seq
  83005136     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499917334     gbphg1.seq
 499956644     gbphg2.seq
 499674268     gbphg3.seq
 499992976     gbphg4.seq
 499963739     gbphg5.seq
 499711831     gbphg6.seq
 318551835     gbphg7.seq
 499999377     gbpln1.seq
 269118160     gbpln10.seq
 457901321     gbpln100.seq
 961290953     gbpln1000.se
1090804563     gbpln1001.se
 813694519     gbpln1002.se
 962545329     gbpln1003.se
 873725320     gbpln1004.se
 673190933     gbpln1005.se
 905064827     gbpln1006.se
 908590683     gbpln1007.se
 742712721     gbpln1008.se
 793279947     gbpln1009.se
 433637011     gbpln101.seq
 934932910     gbpln1010.se
 640700841     gbpln1011.se
 961568347     gbpln1012.se
 952066710     gbpln1013.se
 827214106     gbpln1014.se
 455119463     gbpln1015.se
 225763300     gbpln1016.se
 606043563     gbpln1017.se
 672463180     gbpln1018.se
 670817640     gbpln1019.se
 498225039     gbpln102.seq
 780744113     gbpln1020.se
 709786567     gbpln1021.se
 699981617     gbpln1022.se
 605149310     gbpln1023.se
 587850602     gbpln1024.se
 521338175     gbpln1025.se
 584041492     gbpln1026.se
 586940643     gbpln1027.se
 609718060     gbpln1028.se
 520752755     gbpln1029.se
 107502929     gbpln103.seq
 615367060     gbpln1030.se
 678802711     gbpln1031.se
 605705355     gbpln1032.se
 527901084     gbpln1033.se
 594666479     gbpln1034.se
 615720931     gbpln1035.se
 576353842     gbpln1036.se
 633125968     gbpln1037.se
 548771039     gbpln1038.se
 692441981     gbpln1039.se
 449964743     gbpln104.seq
 738372778     gbpln1040.se
 858786664     gbpln1041.se
 737516180     gbpln1042.se
 745059845     gbpln1043.se
 651602931     gbpln1044.se
 604402507     gbpln1045.se
 664905907     gbpln1046.se
 584308834     gbpln1047.se
 534160882     gbpln1048.se
 630362066     gbpln1049.se
 422837726     gbpln105.seq
 371796209     gbpln1050.se
 630301724     gbpln1051.se
 687847933     gbpln1052.se
 613107926     gbpln1053.se
 667786023     gbpln1054.se
 650171878     gbpln1055.se
 580307353     gbpln1056.se
 567733853     gbpln1057.se
 731990321     gbpln1058.se
 671427711     gbpln1059.se
 383453844     gbpln106.seq
 677581066     gbpln1060.se
 698173276     gbpln1061.se
 745221979     gbpln1062.se
 582651725     gbpln1063.se
 703621805     gbpln1064.se
 577456794     gbpln1065.se
 645348756     gbpln1066.se
 738102835     gbpln1067.se
 718402115     gbpln1068.se
 581705856     gbpln1069.se
 376172116     gbpln107.seq
 731196779     gbpln1070.se
 559541978     gbpln1071.se
 676833494     gbpln1072.se
   5774757     gbpln1073.se
 777312365     gbpln1074.se
1006352200     gbpln1075.se
 962815280     gbpln1076.se
 975138625     gbpln1077.se
 906550424     gbpln1078.se
 790269620     gbpln1079.se
 326317073     gbpln108.seq
 956926035     gbpln1080.se
 908369815     gbpln1081.se
1035806384     gbpln1082.se
1095241385     gbpln1083.se
 889046376     gbpln1084.se
 920177987     gbpln1085.se
 934896188     gbpln1086.se
 972756495     gbpln1087.se
 639243889     gbpln1088.se
 839211115     gbpln1089.se
 320571253     gbpln109.seq
 802168718     gbpln1090.se
 677231764     gbpln1091.se
 740101370     gbpln1092.se
 642539819     gbpln1093.se
 835613564     gbpln1094.se
 284703680     gbpln1095.se
 252385106     gbpln1096.se
 408962040     gbpln1097.se
 329779394     gbpln1098.se
 332794405     gbpln1099.se
 499923203     gbpln11.seq
 286199717     gbpln110.seq
 418495190     gbpln1100.se
 443558620     gbpln1101.se
 449429604     gbpln1102.se
 403262217     gbpln1103.se
 477398794     gbpln1104.se
 434382533     gbpln1105.se
 443534394     gbpln1106.se
 444327808     gbpln1107.se
 486802330     gbpln1108.se
 482267024     gbpln1109.se
 277716232     gbpln111.seq
 434636456     gbpln1110.se
 412605138     gbpln1111.se
 487251125     gbpln1112.se
 475655684     gbpln1113.se
 480193091     gbpln1114.se
 445118181     gbpln1115.se
  94040672     gbpln1116.se
 598056432     gbpln1117.se
 774899231     gbpln1118.se
 723495077     gbpln1119.se
 499733064     gbpln112.seq
 714415063     gbpln1120.se
 677999218     gbpln1121.se
 629027474     gbpln1122.se
 732833309     gbpln1123.se
 468675756     gbpln1124.se
 493398868     gbpln1125.se
 474782479     gbpln1126.se
 380660146     gbpln1127.se
 467902933     gbpln1128.se
 216458899     gbpln1129.se
  79413547     gbpln113.seq
 767568441     gbpln1130.se
 890586336     gbpln1131.se
 628166166     gbpln1132.se
1008494770     gbpln1133.se
 987228440     gbpln1134.se
 843057146     gbpln1135.se
 959088227     gbpln1136.se
1080118900     gbpln1137.se
 790032689     gbpln1138.se
 943744808     gbpln1139.se
 391026516     gbpln114.seq
 858758923     gbpln1140.se
 664109824     gbpln1141.se
 920678548     gbpln1142.se
 888501597     gbpln1143.se
 739915904     gbpln1144.se
 788736236     gbpln1145.se
 944601115     gbpln1146.se
 621465899     gbpln1147.se
 948555731     gbpln1148.se
 954911743     gbpln1149.se
 362500947     gbpln115.seq
 815610131     gbpln1150.se
  39280886     gbpln1151.se
 752395252     gbpln1152.se
 890282442     gbpln1153.se
 626588938     gbpln1154.se
1004358314     gbpln1155.se
1028945403     gbpln1156.se
 838465031     gbpln1157.se
 950517848     gbpln1158.se
1082441571     gbpln1159.se
 390024685     gbpln116.seq
 789583362     gbpln1160.se
 950035126     gbpln1161.se
 853507174     gbpln1162.se
 659807143     gbpln1163.se
 902654822     gbpln1164.se
 890952840     gbpln1165.se
 721824595     gbpln1166.se
 785634143     gbpln1167.se
 909002041     gbpln1168.se
 625532226     gbpln1169.se
 341773035     gbpln117.seq
 945667285     gbpln1170.se
 953425673     gbpln1171.se
 821771932     gbpln1172.se
  49706327     gbpln1173.se
 685151081     gbpln1174.se
 568933209     gbpln1175.se
 539200808     gbpln1176.se
 586715519     gbpln1177.se
 614750081     gbpln1178.se
 568071416     gbpln1179.se
 199854531     gbpln118.seq
 625152560     gbpln1180.se
 586214274     gbpln1181.se
 746226478     gbpln1182.se
 808684470     gbpln1183.se
 907082919     gbpln1184.se
 776688265     gbpln1185.se
 793241327     gbpln1186.se
 698857036     gbpln1187.se
 613368022     gbpln1188.se
 674019106     gbpln1189.se
 483137958     gbpln119.seq
 609236735     gbpln1190.se
 576791005     gbpln1191.se
 632369216     gbpln1192.se
 377507569     gbpln1193.se
 669127828     gbpln1194.se
 480140219     gbpln1195.se
 475319448     gbpln1196.se
 488174600     gbpln1197.se
 318504222     gbpln1198.se
 198085068     gbpln1199.se
 498720815     gbpln12.seq
 493810296     gbpln120.seq
 752395252     gbpln1200.se
 890282442     gbpln1201.se
 626588938     gbpln1202.se
1004358314     gbpln1203.se
1028945403     gbpln1204.se
 838465031     gbpln1205.se
 950517848     gbpln1206.se
1082441571     gbpln1207.se
 789583362     gbpln1208.se
 950035126     gbpln1209.se
 497201313     gbpln121.seq
 853507174     gbpln1210.se
 659807143     gbpln1211.se
 902654822     gbpln1212.se
 890952840     gbpln1213.se
 721824595     gbpln1214.se
 785634143     gbpln1215.se
 909002041     gbpln1216.se
 625532226     gbpln1217.se
 945667285     gbpln1218.se
 953425673     gbpln1219.se
 262329677     gbpln122.seq
 821771932     gbpln1220.se
 459041667     gbpln1221.se
 304578983     gbpln1222.se
 571276484     gbpln1223.se
 841140963     gbpln1224.se
 813242081     gbpln1225.se
 666749684     gbpln1226.se
 786164670     gbpln1227.se
 685610369     gbpln1228.se
 780661607     gbpln1229.se
 410692589     gbpln123.seq
  20764769     gbpln1230.se
 494104735     gbpln1231.se
 487719162     gbpln1232.se
 475203143     gbpln1233.se
 481053138     gbpln1234.se
 491971790     gbpln1235.se
 174964113     gbpln1236.se
 489989534     gbpln1237.se
 498671512     gbpln1238.se
 498654651     gbpln1239.se
 485439355     gbpln124.seq
 472130628     gbpln1240.se
 484783481     gbpln1241.se
 174534000     gbpln1242.se
 458581762     gbpln1243.se
 487249767     gbpln1244.se
 488104602     gbpln1245.se
 490993470     gbpln1246.se
 458758162     gbpln1247.se
 243752045     gbpln1248.se
 496284751     gbpln1249.se
 339967820     gbpln125.seq
 470894249     gbpln1250.se
 456702113     gbpln1251.se
 468851576     gbpln1252.se
 498668450     gbpln1253.se
 246543998     gbpln1254.se
 403648092     gbpln1255.se
 420333785     gbpln1256.se
 486138903     gbpln1257.se
 461617634     gbpln1258.se
 214014145     gbpln1259.se
 410604091     gbpln126.seq
 461722879     gbpln1260.se
 470401116     gbpln1261.se
 494676807     gbpln1262.se
 492353397     gbpln1263.se
 492252570     gbpln1264.se
 345527633     gbpln1265.se
 463862211     gbpln1266.se
 494081914     gbpln1267.se
 482259033     gbpln1268.se
 440622839     gbpln1269.se
 459875355     gbpln127.seq
 491838433     gbpln1270.se
 412558016     gbpln1271.se
 201913689     gbpln1272.se
 437115790     gbpln1273.se
 441097064     gbpln1274.se
 442410423     gbpln1275.se
 451274488     gbpln1276.se
 251536188     gbpln1277.se
 422420084     gbpln1278.se
 498624032     gbpln1279.se
 499126764     gbpln128.seq
 493876654     gbpln1280.se
 461367203     gbpln1281.se
 368984003     gbpln1282.se
 327296104     gbpln1283.se
 393553638     gbpln1284.se
 494499660     gbpln1285.se
 339690898     gbpln1286.se
 442962794     gbpln1287.se
 443202510     gbpln1288.se
 473793657     gbpln1289.se
 182005254     gbpln129.seq
 487062259     gbpln1290.se
 402248903     gbpln1291.se
 441515110     gbpln1292.se
 497650728     gbpln1293.se
 425883871     gbpln1294.se
 363732401     gbpln1295.se
 454836169     gbpln1296.se
 473634452     gbpln1297.se
 202150508     gbpln1298.se
 470919442     gbpln1299.se
 470019057     gbpln13.seq
 498973295     gbpln130.seq
 485212352     gbpln1300.se
 473559497     gbpln1301.se
 436659501     gbpln1302.se
 334662259     gbpln1303.se
1096228946     gbpln1304.se
1065747702     gbpln1305.se
 978382754     gbpln1306.se
 970377846     gbpln1307.se
 932157798     gbpln1308.se
 878151181     gbpln1309.se
 472540038     gbpln131.seq
 874085482     gbpln1310.se
 829265283     gbpln1311.se
 863296713     gbpln1312.se
 823515697     gbpln1313.se
 815413879     gbpln1314.se
 693494316     gbpln1315.se
 690790562     gbpln1316.se
 669344399     gbpln1317.se
 682118426     gbpln1318.se
 617460029     gbpln1319.se
 453105795     gbpln132.seq
 613278884     gbpln1320.se
 540591172     gbpln1321.se
   1142716     gbpln1322.se
2012725365     gbpln1323.se
2313576157     gbpln1324.se
2199353951     gbpln1325.se
2096617949     gbpln1326.se
2106642321     gbpln1327.se
1745413840     gbpln1328.se
1943630374     gbpln1329.se
 445429529     gbpln133.seq
  43805282     gbpln1330.se
 396348078     gbpln1331.se
 656016969     gbpln1332.se
 836152674     gbpln1333.se
 790234195     gbpln1334.se
 768134127     gbpln1335.se
 758776841     gbpln1336.se
 705400447     gbpln1337.se
 794343595     gbpln1338.se
 660040390     gbpln1339.se
 387853287     gbpln134.seq
 839765735     gbpln1340.se
 794136796     gbpln1341.se
 777214952     gbpln1342.se
 750731321     gbpln1343.se
 709232633     gbpln1344.se
 800824124     gbpln1345.se
 653086622     gbpln1346.se
 831555005     gbpln1347.se
 787385082     gbpln1348.se
 774061569     gbpln1349.se
 496158204     gbpln135.seq
 746196125     gbpln1350.se
 697845631     gbpln1351.se
 802432660     gbpln1352.se
 659592617     gbpln1353.se
 837904863     gbpln1354.se
 793009109     gbpln1355.se
 770582516     gbpln1356.se
 754317819     gbpln1357.se
 704675048     gbpln1358.se
 809917663     gbpln1359.se
 498225578     gbpln136.seq
 662753085     gbpln1360.se
 837974599     gbpln1361.se
 802983166     gbpln1362.se
 776399715     gbpln1363.se
 749269998     gbpln1364.se
 702806422     gbpln1365.se
 795297690     gbpln1366.se
 672385035     gbpln1367.se
 841987687     gbpln1368.se
 800255274     gbpln1369.se
 499068542     gbpln137.seq
 776782163     gbpln1370.se
 765490378     gbpln1371.se
 737409431     gbpln1372.se
 809700114     gbpln1373.se
 657854557     gbpln1374.se
 838067529     gbpln1375.se
 794050155     gbpln1376.se
 769006557     gbpln1377.se
 754403386     gbpln1378.se
 702133895     gbpln1379.se
 322836027     gbpln138.seq
 796622308     gbpln1380.se
 659801577     gbpln1381.se
 831709070     gbpln1382.se
 788018842     gbpln1383.se
 776335169     gbpln1384.se
 746238486     gbpln1385.se
 700989570     gbpln1386.se
 807667792     gbpln1387.se
 654391424     gbpln1388.se
 831948388     gbpln1389.se
 489314553     gbpln139.seq
 792155198     gbpln1390.se
 764395262     gbpln1391.se
 746678920     gbpln1392.se
 722347699     gbpln1393.se
 803791473     gbpln1394.se
 653243978     gbpln1395.se
 832913531     gbpln1396.se
 783381753     gbpln1397.se
 777226068     gbpln1398.se
 745655004     gbpln1399.se
 170607032     gbpln14.seq
 486163971     gbpln140.seq
 703355435     gbpln1400.se
 800066153     gbpln1401.se
 659967910     gbpln1402.se
 856583956     gbpln1403.se
 800941652     gbpln1404.se
 764839742     gbpln1405.se
 750893358     gbpln1406.se
 712544595     gbpln1407.se
 794775316     gbpln1408.se
 662436378     gbpln1409.se
 495247758     gbpln141.seq
 838548263     gbpln1410.se
 802434969     gbpln1411.se
 775426580     gbpln1412.se
 752476251     gbpln1413.se
 715776003     gbpln1414.se
 800430027     gbpln1415.se
 656566519     gbpln1416.se
 836584181     gbpln1417.se
 794556424     gbpln1418.se
 763379903     gbpln1419.se
 466229178     gbpln142.seq
 746277662     gbpln1420.se
 726262980     gbpln1421.se
 792340702     gbpln1422.se
 675115613     gbpln1423.se
 841588738     gbpln1424.se
 793586134     gbpln1425.se
 774193867     gbpln1426.se
 770687431     gbpln1427.se
 712905176     gbpln1428.se
 810458180     gbpln1429.se
 493826666     gbpln143.seq
 654272797     gbpln1430.se
 832767208     gbpln1431.se
 787519848     gbpln1432.se
 773580779     gbpln1433.se
 746701676     gbpln1434.se
 707267128     gbpln1435.se
 798980729     gbpln1436.se
 659896519     gbpln1437.se
 836647346     gbpln1438.se
 804025439     gbpln1439.se
 495604408     gbpln144.seq
 780287538     gbpln1440.se
 743595303     gbpln1441.se
 713315315     gbpln1442.se
 803845677     gbpln1443.se
 657271061     gbpln1444.se
 847868246     gbpln1445.se
 799503372     gbpln1446.se
 769858206     gbpln1447.se
 741623589     gbpln1448.se
 709760988     gbpln1449.se
 494888145     gbpln145.seq
 792929198     gbpln1450.se
 655249257     gbpln1451.se
 841182041     gbpln1452.se
 790643458     gbpln1453.se
 771991396     gbpln1454.se
 747914331     gbpln1455.se
 701991886     gbpln1456.se
 799948094     gbpln1457.se
 836052023     gbpln1458.se
 791807903     gbpln1459.se
 496855421     gbpln146.seq
 771195581     gbpln1460.se
 751946992     gbpln1461.se
 700679711     gbpln1462.se
 795423860     gbpln1463.se
 657438591     gbpln1464.se
 666670554     gbpln1465.se
 841954477     gbpln1466.se
 801058908     gbpln1467.se
 777293273     gbpln1468.se
 749498940     gbpln1469.se
 498616424     gbpln147.seq
 736280932     gbpln1470.se
 793092204     gbpln1471.se
 659821185     gbpln1472.se
 836617455     gbpln1473.se
 790837080     gbpln1474.se
 777459211     gbpln1475.se
 747254822     gbpln1476.se
 706272554     gbpln1477.se
 799311150     gbpln1478.se
 655470686     gbpln1479.se
  91590399     gbpln148.seq
 839842771     gbpln1480.se
 793797446     gbpln1481.se
 776363695     gbpln1482.se
 740130332     gbpln1483.se
 716642316     gbpln1484.se
 788558880     gbpln1485.se
 678011370     gbpln1486.se
 845148876     gbpln1487.se
 804833075     gbpln1488.se
 778470840     gbpln1489.se
 485225820     gbpln149.seq
 756070229     gbpln1490.se
 724936708     gbpln1491.se
 811860442     gbpln1492.se
 662208657     gbpln1493.se
 794180240     gbpln1494.se
 774312133     gbpln1495.se
 754828857     gbpln1496.se
 702475124     gbpln1497.se
 835115958     gbpln1498.se
 799156315     gbpln1499.se
 496189944     gbpln15.seq
 474996855     gbpln150.seq
 658470916     gbpln1500.se
 836718376     gbpln1501.se
 801816184     gbpln1502.se
 780710757     gbpln1503.se
 754364739     gbpln1504.se
 733491153     gbpln1505.se
 805725430     gbpln1506.se
 662648934     gbpln1507.se
 835020955     gbpln1508.se
 794498288     gbpln1509.se
 477161896     gbpln151.seq
 775035874     gbpln1510.se
 744045587     gbpln1511.se
 730876361     gbpln1512.se
 803645921     gbpln1513.se
 656056550     gbpln1514.se
 836763144     gbpln1515.se
 794319485     gbpln1516.se
 771563218     gbpln1517.se
 743186864     gbpln1518.se
 699149444     gbpln1519.se
 340348460     gbpln152.seq
 796083444     gbpln1520.se
 665841375     gbpln1521.se
 835744193     gbpln1522.se
 793808494     gbpln1523.se
 775366859     gbpln1524.se
 744449290     gbpln1525.se
 708201546     gbpln1526.se
 799207549     gbpln1527.se
 662253837     gbpln1528.se
 839340148     gbpln1529.se
 484543870     gbpln153.seq
 793588555     gbpln1530.se
 778845059     gbpln1531.se
 755025577     gbpln1532.se
 716488813     gbpln1533.se
 801939933     gbpln1534.se
 658732786     gbpln1535.se
 847689175     gbpln1536.se
 797030463     gbpln1537.se
 776617524     gbpln1538.se
 745737830     gbpln1539.se
 490914318     gbpln154.seq
 704496294     gbpln1540.se
 807597004     gbpln1541.se
 662054725     gbpln1542.se
 834034797     gbpln1543.se
 795540701     gbpln1544.se
 776376885     gbpln1545.se
 750640507     gbpln1546.se
 698264887     gbpln1547.se
 797586817     gbpln1548.se
 660069753     gbpln1549.se
 481177815     gbpln155.seq
 833009352     gbpln1550.se
 797524540     gbpln1551.se
 773297930     gbpln1552.se
 748668787     gbpln1553.se
 702576368     gbpln1554.se
 798959670     gbpln1555.se
 655233812     gbpln1556.se
 830169429     gbpln1557.se
 793310457     gbpln1558.se
 773560290     gbpln1559.se
 496102157     gbpln156.seq
 748590167     gbpln1560.se
 697641990     gbpln1561.se
 792556201     gbpln1562.se
 658381368     gbpln1563.se
 835938341     gbpln1564.se
 795056321     gbpln1565.se
 770765157     gbpln1566.se
 758436824     gbpln1567.se
 717124966     gbpln1568.se
 798421217     gbpln1569.se
 423060186     gbpln157.seq
 668158294     gbpln1570.se
 829099164     gbpln1571.se
 790989379     gbpln1572.se
 773398673     gbpln1573.se
 750444053     gbpln1574.se
 711602485     gbpln1575.se
 797006147     gbpln1576.se
 652904161     gbpln1577.se
 837413052     gbpln1578.se
 790648527     gbpln1579.se
 497478474     gbpln158.seq
 772176401     gbpln1580.se
 747834533     gbpln1581.se
 712785774     gbpln1582.se
 792713783     gbpln1583.se
 663052369     gbpln1584.se
 833059054     gbpln1585.se
 794545184     gbpln1586.se
 774083177     gbpln1587.se
 746226026     gbpln1588.se
 702720993     gbpln1589.se
 435184009     gbpln159.seq
 802877509     gbpln1590.se
 655682341     gbpln1591.se
 835451342     gbpln1592.se
 794577233     gbpln1593.se
 775251446     gbpln1594.se
 745423892     gbpln1595.se
 709108135     gbpln1596.se
 801224896     gbpln1597.se
 662394359     gbpln1598.se
 836809812     gbpln1599.se
 479250208     gbpln16.seq
 460820205     gbpln160.seq
 806584862     gbpln1600.se
 776084155     gbpln1601.se
 742536325     gbpln1602.se
 742539602     gbpln1603.se
 790043912     gbpln1604.se
 658808619     gbpln1605.se
 836125457     gbpln1606.se
 794049612     gbpln1607.se
 769729355     gbpln1608.se
 742587081     gbpln1609.se
 485737542     gbpln161.seq
 727014800     gbpln1610.se
 797674105     gbpln1611.se
 660687462     gbpln1612.se
 840008504     gbpln1613.se
 794029694     gbpln1614.se
 769623341     gbpln1615.se
 748398121     gbpln1616.se
 729084759     gbpln1617.se
 800520588     gbpln1618.se
 656029206     gbpln1619.se
 498612562     gbpln162.seq
 836931236     gbpln1620.se
 792455888     gbpln1621.se
 768695354     gbpln1622.se
 749845408     gbpln1623.se
 701064052     gbpln1624.se
 795314881     gbpln1625.se
 659612022     gbpln1626.se
 835570197     gbpln1627.se
 798619346     gbpln1628.se
 776375847     gbpln1629.se
 485304962     gbpln163.seq
 751020200     gbpln1630.se
 717192214     gbpln1631.se
 803740372     gbpln1632.se
 659779517     gbpln1633.se
 832456199     gbpln1634.se
 793920035     gbpln1635.se
 773324985     gbpln1636.se
 742351220     gbpln1637.se
 701296730     gbpln1638.se
 793436257     gbpln1639.se
 499875093     gbpln164.seq
 665530976     gbpln1640.se
 834886228     gbpln1641.se
 792465315     gbpln1642.se
 766375549     gbpln1643.se
 744587278     gbpln1644.se
 704762183     gbpln1645.se
 794348716     gbpln1646.se
 663323329     gbpln1647.se
 836173230     gbpln1648.se
 792990723     gbpln1649.se
 396643341     gbpln165.seq
 774691916     gbpln1650.se
 742761704     gbpln1651.se
 709671068     gbpln1652.se
 797342703     gbpln1653.se
 711562738     gbpln1654.se
 785075543     gbpln1655.se
 804070482     gbpln1656.se
 777569920     gbpln1657.se
 748606451     gbpln1658.se
 712552461     gbpln1659.se
 174767189     gbpln166.seq
 803554148     gbpln1660.se
 663200246     gbpln1661.se
 830451601     gbpln1662.se
 798616435     gbpln1663.se
 774880678     gbpln1664.se
 741636674     gbpln1665.se
 713582127     gbpln1666.se
 802021531     gbpln1667.se
 658502066     gbpln1668.se
 837230145     gbpln1669.se
 336937021     gbpln167.seq
 796560308     gbpln1670.se
 777015504     gbpln1671.se
 751686997     gbpln1672.se
 703906948     gbpln1673.se
 801647364     gbpln1674.se
 654064285     gbpln1675.se
 838785071     gbpln1676.se
 791233293     gbpln1677.se
 770014685     gbpln1678.se
 746107403     gbpln1679.se
 481782456     gbpln168.seq
 703906054     gbpln1680.se
 795356170     gbpln1681.se
 659953546     gbpln1682.se
 835677720     gbpln1683.se
 793372574     gbpln1684.se
 769401747     gbpln1685.se
 752854041     gbpln1686.se
 703690888     gbpln1687.se
 796975856     gbpln1688.se
 668337863     gbpln1689.se
 432553122     gbpln169.seq
 839230685     gbpln1690.se
 803963907     gbpln1691.se
 778586682     gbpln1692.se
 744232293     gbpln1693.se
 718898368     gbpln1694.se
 798701082     gbpln1695.se
 659027881     gbpln1696.se
 832496071     gbpln1697.se
 797513192     gbpln1698.se
 776551156     gbpln1699.se
 335223965     gbpln17.seq
 462278275     gbpln170.seq
 746618245     gbpln1700.se
 703227861     gbpln1701.se
 798793860     gbpln1702.se
 661700145     gbpln1703.se
 839860091     gbpln1704.se
 789840368     gbpln1705.se
 776969912     gbpln1706.se
 742781648     gbpln1707.se
 707704955     gbpln1708.se
 799711544     gbpln1709.se
 338514050     gbpln171.seq
 214717737     gbpln1710.se
 477983665     gbpln1711.se
 479133534     gbpln1712.se
 489619458     gbpln1713.se
 483060400     gbpln1714.se
 446936322     gbpln1715.se
 207970098     gbpln1716.se
 460655312     gbpln1717.se
 364708423     gbpln1718.se
 339216276     gbpln1719.se
 478622058     gbpln172.seq
 386345512     gbpln1720.se
 311846069     gbpln1721.se
 213922978     gbpln1722.se
 547084404     gbpln1723.se
    299808     gbpln1724.se
 575997766     gbpln1725.se
 565057145     gbpln1726.se
 546636235     gbpln1727.se
 480735429     gbpln1728.se
 428611956     gbpln1729.se
 276524733     gbpln173.seq
 399987344     gbpln1730.se
 452012654     gbpln1731.se
 407833644     gbpln1732.se
  98616602     gbpln1733.se
 487423636     gbpln1734.se
 415841860     gbpln1735.se
 659287868     gbpln1736.se
 830295693     gbpln1737.se
 794035728     gbpln1738.se
 766241777     gbpln1739.se
 445190576     gbpln174.seq
 750933536     gbpln1740.se
 701025885     gbpln1741.se
 801757538     gbpln1742.se
 658504885     gbpln1743.se
 800420442     gbpln1744.se
 807100878     gbpln1745.se
 813165275     gbpln1746.se
 763582995     gbpln1747.se
 726276065     gbpln1748.se
 802736565     gbpln1749.se
 357274162     gbpln175.seq
 660909128     gbpln1750.se
 836403024     gbpln1751.se
 797704105     gbpln1752.se
 771673145     gbpln1753.se
 763841398     gbpln1754.se
 725232624     gbpln1755.se
 803038467     gbpln1756.se
 659962386     gbpln1757.se
 835021143     gbpln1758.se
 794511021     gbpln1759.se
 375890576     gbpln176.seq
 765022116     gbpln1760.se
 746128141     gbpln1761.se
 704302152     gbpln1762.se
 788898001     gbpln1763.se
 657496944     gbpln1764.se
 837987830     gbpln1765.se
 795104781     gbpln1766.se
 772053911     gbpln1767.se
 744822794     gbpln1768.se
 709518859     gbpln1769.se
 349832882     gbpln177.seq
 798243211     gbpln1770.se
 454828836     gbpln1771.se
 378680463     gbpln1772.se
  79782982     gbpln1773.se
 610632167     gbpln1774.se
 761027417     gbpln1775.se
 474894144     gbpln1776.se
 820639220     gbpln1777.se
 834487583     gbpln1778.se
 646503636     gbpln1779.se
 336189913     gbpln178.seq
 791663935     gbpln1780.se
 942730875     gbpln1781.se
 611720944     gbpln1782.se
 801353716     gbpln1783.se
 755984392     gbpln1784.se
 515950587     gbpln1785.se
 730612021     gbpln1786.se
 754956047     gbpln1787.se
 552345645     gbpln1788.se
 632515095     gbpln1789.se
 463740200     gbpln179.seq
 756169196     gbpln1790.se
 470848206     gbpln1791.se
 774219381     gbpln1792.se
 818888469     gbpln1793.se
 623527102     gbpln1794.se
 498525119     gbpln1795.se
 482321806     gbpln1796.se
 457141996     gbpln1797.se
 469346005     gbpln1798.se
 323635207     gbpln1799.se
 418823303     gbpln18.seq
 393476964     gbpln180.seq
 498969871     gbpln1800.se
 499320075     gbpln1801.se
 491583750     gbpln1802.se
 487185903     gbpln1803.se
 182220271     gbpln1804.se
 377272807     gbpln1805.se
 626278050     gbpln1806.se
 818534977     gbpln1807.se
 744338029     gbpln1808.se
 840481828     gbpln1809.se
 114312500     gbpln181.seq
 794009713     gbpln1810.se
 688256286     gbpln1811.se
 841577973     gbpln1812.se
  25762175     gbpln1813.se
 665178568     gbpln1814.se
 840478319     gbpln1815.se
 804862544     gbpln1816.se
 775136193     gbpln1817.se
 749151155     gbpln1818.se
 707736695     gbpln1819.se
 430007058     gbpln182.seq
 809488365     gbpln1820.se
 661228590     gbpln1821.se
 836948259     gbpln1822.se
 794972859     gbpln1823.se
 775455598     gbpln1824.se
 752931639     gbpln1825.se
 710188072     gbpln1826.se
 794996206     gbpln1827.se
 656305255     gbpln1828.se
 852997313     gbpln1829.se
 485882010     gbpln183.seq
 798187575     gbpln1830.se
 776406263     gbpln1831.se
 749661142     gbpln1832.se
 708724373     gbpln1833.se
 804700406     gbpln1834.se
 659125980     gbpln1835.se
 833048862     gbpln1836.se
 794071582     gbpln1837.se
 772684697     gbpln1838.se
 754758102     gbpln1839.se
 403795990     gbpln184.seq
 700069996     gbpln1840.se
 793225130     gbpln1841.se
 658436221     gbpln1842.se
 839152730     gbpln1843.se
 798464996     gbpln1844.se
 775710033     gbpln1845.se
 744924658     gbpln1846.se
 719062576     gbpln1847.se
 798410686     gbpln1848.se
 657106543     gbpln1849.se
 451516767     gbpln185.seq
 827472017     gbpln1850.se
 799696373     gbpln1851.se
 771541363     gbpln1852.se
 743322371     gbpln1853.se
 712776428     gbpln1854.se
 793860153     gbpln1855.se
 656608371     gbpln1856.se
 830011447     gbpln1857.se
 803324869     gbpln1858.se
 778613518     gbpln1859.se
 382592005     gbpln186.seq
 757477427     gbpln1860.se
 728058413     gbpln1861.se
 793687618     gbpln1862.se
 666598482     gbpln1863.se
 834396522     gbpln1864.se
 793156442     gbpln1865.se
 771664945     gbpln1866.se
 746127866     gbpln1867.se
 714848466     gbpln1868.se
 809569982     gbpln1869.se
 457726110     gbpln187.seq
 663177934     gbpln1870.se
 831402033     gbpln1871.se
 788227480     gbpln1872.se
 773608315     gbpln1873.se
 756195357     gbpln1874.se
 703056123     gbpln1875.se
 797970460     gbpln1876.se
 659145675     gbpln1877.se
 833114761     gbpln1878.se
 791988363     gbpln1879.se
 493420618     gbpln188.seq
 773778680     gbpln1880.se
 736302365     gbpln1881.se
 703036009     gbpln1882.se
 798246923     gbpln1883.se
 661431559     gbpln1884.se
 832582978     gbpln1885.se
 790630518     gbpln1886.se
 774554078     gbpln1887.se
 746769221     gbpln1888.se
 712662432     gbpln1889.se
 497715243     gbpln189.seq
 792723541     gbpln1890.se
 669899614     gbpln1891.se
 841885928     gbpln1892.se
 814740283     gbpln1893.se
 781686950     gbpln1894.se
 765848634     gbpln1895.se
 704928652     gbpln1896.se
 817350531     gbpln1897.se
 656762766     gbpln1898.se
 836345572     gbpln1899.se
 496016838     gbpln19.seq
 494847899     gbpln190.seq
 803943397     gbpln1900.se
 776352617     gbpln1901.se
 747411545     gbpln1902.se
 714330949     gbpln1903.se
 802296973     gbpln1904.se
 665963375     gbpln1905.se
 833628952     gbpln1906.se
 800337028     gbpln1907.se
 775679569     gbpln1908.se
 756201475     gbpln1909.se
 147147531     gbpln191.seq
 729171201     gbpln1910.se
 803715547     gbpln1911.se
 666969206     gbpln1912.se
 837791026     gbpln1913.se
 805450455     gbpln1914.se
 782697461     gbpln1915.se
 750312638     gbpln1916.se
 712090922     gbpln1917.se
 810098655     gbpln1918.se
 661446766     gbpln1919.se
 490697083     gbpln192.seq
 844251896     gbpln1920.se
 800661389     gbpln1921.se
 770104661     gbpln1922.se
 746196369     gbpln1923.se
 740624627     gbpln1924.se
 810764368     gbpln1925.se
 430820664     gbpln1926.se
 439418037     gbpln1927.se
 495349376     gbpln1928.se
 420755197     gbpln1929.se
 492045809     gbpln193.seq
  79867313     gbpln1930.se
 477385948     gbpln1931.se
 471883612     gbpln1932.se
 478940659     gbpln1933.se
 333989198     gbpln1934.se
 253005912     gbpln1935.se
 436323528     gbpln1936.se
 474062172     gbpln1937.se
 483649355     gbpln1938.se
 403534786     gbpln1939.se
 495011653     gbpln194.seq
 498892972     gbpln1940.se
 201620526     gbpln1941.se
 492206431     gbpln1942.se
 431247284     gbpln1943.se
 485331477     gbpln1944.se
 499128952     gbpln1945.se
 446943656     gbpln1946.se
 445678707     gbpln1947.se
 492931817     gbpln1948.se
 488728965     gbpln1949.se
 375787291     gbpln195.seq
 442513917     gbpln1950.se
 489986240     gbpln1951.se
 485052602     gbpln1952.se
 402707116     gbpln1953.se
 484676594     gbpln1954.se
 457870134     gbpln1955.se
 485317363     gbpln1956.se
 412333094     gbpln1957.se
 414213485     gbpln1958.se
 392278204     gbpln1959.se
 459748362     gbpln196.seq
 252441040     gbpln1960.se
 483659967     gbpln1961.se
 467301410     gbpln1962.se
 405580660     gbpln1963.se
 457115946     gbpln1964.se
  70190485     gbpln1965.se
 484439011     gbpln1966.se
 462114796     gbpln1967.se
 463366807     gbpln1968.se
 320374741     gbpln1969.se
 221425534     gbpln197.seq
 395846795     gbpln1970.se
 378719650     gbpln1971.se
 367281367     gbpln1972.se
 338474475     gbpln1973.se
 318607005     gbpln1974.se
 311653033     gbpln1975.se
 283823331     gbpln1976.se
 499365134     gbpln1977.se
 472679926     gbpln1978.se
 111646958     gbpln1979.se
 389473095     gbpln198.seq
 475053211     gbpln1980.se
 410147052     gbpln1981.se
 437551134     gbpln1982.se
 453268537     gbpln1983.se
 377240170     gbpln1984.se
2734223096     gbpln1985.se
2727931901     gbpln1986.se
2720692598     gbpln1987.se
2732441076     gbpln1988.se
2733260927     gbpln1989.se
 304823814     gbpln199.seq
 157556535     gbpln1990.se
2694271430     gbpln1991.se
2735442486     gbpln1992.se
2720859722     gbpln1993.se
2732011308     gbpln1994.se
2383529845     gbpln1995.se
2723191931     gbpln1996.se
2689474086     gbpln1997.se
2737751830     gbpln1998.se
2700210160     gbpln1999.se
 499846796     gbpln2.seq
 243286344     gbpln20.seq
 301383681     gbpln200.seq
2006289519     gbpln2000.se
2636141786     gbpln2001.se
2722875815     gbpln2002.se
2725415454     gbpln2003.se
2730393002     gbpln2004.se
1948886785     gbpln2005.se
2738131093     gbpln2006.se
2727379378     gbpln2007.se
2679871098     gbpln2008.se
2737685310     gbpln2009.se
 318452230     gbpln201.seq
 786720890     gbpln2010.se
2727907345     gbpln2011.se
2657432129     gbpln2012.se
2735229991     gbpln2013.se
2728645371     gbpln2014.se
 218791011     gbpln2015.se
2719617838     gbpln2016.se
2721885171     gbpln2017.se
2721092581     gbpln2018.se
2679558604     gbpln2019.se
 281218213     gbpln202.seq
 181580803     gbpln2020.se
2722179116     gbpln2021.se
2736369220     gbpln2022.se
2726783046     gbpln2023.se
2440060122     gbpln2024.se
2736724965     gbpln2025.se
2696541624     gbpln2026.se
 422496617     gbpln2027.se
2731302183     gbpln2028.se
2702984894     gbpln2029.se
 447505205     gbpln203.seq
2732485324     gbpln2030.se
1906858977     gbpln2031.se
1292626852     gbpln2032.se
 407499681     gbpln2033.se
 471674647     gbpln2034.se
 392501299     gbpln2035.se
 471465881     gbpln2036.se
 465574138     gbpln2037.se
 440952437     gbpln2038.se
 575645529     gbpln2039.se
 228460638     gbpln204.seq
 734445378     gbpln2040.se
 697159202     gbpln2041.se
 621889642     gbpln2042.se
 656718843     gbpln2043.se
 558783862     gbpln2044.se
 699089816     gbpln2045.se
 574123634     gbpln2046.se
 721607985     gbpln2047.se
 718233528     gbpln2048.se
 628979866     gbpln2049.se
 497423138     gbpln205.seq
 662283407     gbpln2050.se
 559564406     gbpln2051.se
 726501832     gbpln2052.se
    175851     gbpln2053.se
 558553896     gbpln2054.se
 736054186     gbpln2055.se
 682550439     gbpln2056.se
 616280683     gbpln2057.se
 628026548     gbpln2058.se
 551354059     gbpln2059.se
 495662331     gbpln206.seq
 677933274     gbpln2060.se
 549876381     gbpln2061.se
 689339626     gbpln2062.se
 658635449     gbpln2063.se
 604420911     gbpln2064.se
 622625000     gbpln2065.se
 544618917     gbpln2066.se
 696594014     gbpln2067.se
    174779     gbpln2068.se
 568398582     gbpln2069.se
 444550735     gbpln207.seq
 752800823     gbpln2070.se
 698346119     gbpln2071.se
 608730243     gbpln2072.se
 652235208     gbpln2073.se
 542363484     gbpln2074.se
 702360856     gbpln2075.se
 565600613     gbpln2076.se
 754304818     gbpln2077.se
 711293759     gbpln2078.se
 605904859     gbpln2079.se
 438126854     gbpln208.seq
 666855938     gbpln2080.se
 544952160     gbpln2081.se
 703427667     gbpln2082.se
    174749     gbpln2083.se
 566716389     gbpln2084.se
 718786058     gbpln2085.se
 711087366     gbpln2086.se
 642562848     gbpln2087.se
 647633318     gbpln2088.se
 553626911     gbpln2089.se
 488990760     gbpln209.seq
 565229115     gbpln2090.se
 549156577     gbpln2091.se
 736859608     gbpln2092.se
 691433519     gbpln2093.se
 617624847     gbpln2094.se
 636966542     gbpln2095.se
 552239528     gbpln2096.se
 556957719     gbpln2097.se
    174818     gbpln2098.se
 564066555     gbpln2099.se
 462332174     gbpln21.seq
 492398817     gbpln210.seq
 691947282     gbpln2100.se
 624453167     gbpln2101.se
 568801669     gbpln2102.se
 623008870     gbpln2103.se
 524788928     gbpln2104.se
 645004954     gbpln2105.se
 540958899     gbpln2106.se
 655828783     gbpln2107.se
 520795030     gbpln2108.se
 586540920     gbpln2109.se
 352772052     gbpln211.seq
 597946208     gbpln2110.se
 512499450     gbpln2111.se
 665998603     gbpln2112.se
 549985709     gbpln2113.se
 705073397     gbpln2114.se
 569802481     gbpln2115.se
 551263895     gbpln2116.se
 617715492     gbpln2117.se
 533030891     gbpln2118.se
 642027672     gbpln2119.se
 185131817     gbpln212.seq
 537224178     gbpln2120.se
 670508728     gbpln2121.se
 649315773     gbpln2122.se
 588952556     gbpln2123.se
 605547434     gbpln2124.se
 513253175     gbpln2125.se
 637456772     gbpln2126.se
    174881     gbpln2127.se
 548524272     gbpln2128.se
 711748457     gbpln2129.se
 369359776     gbpln213.seq
 688643289     gbpln2130.se
 589153230     gbpln2131.se
 607494571     gbpln2132.se
 469515369     gbpln2133.se
 596414735     gbpln2134.se
 563516669     gbpln2135.se
 696200282     gbpln2136.se
 602471952     gbpln2137.se
 479557185     gbpln2138.se
 613324917     gbpln2139.se
 360003680     gbpln214.seq
 542743607     gbpln2140.se
 577693408     gbpln2141.se
 515295514     gbpln2142.se
 698832234     gbpln2143.se
 595216266     gbpln2144.se
 522577566     gbpln2145.se
 554145572     gbpln2146.se
 465690537     gbpln2147.se
 637185354     gbpln2148.se
 518213118     gbpln2149.se
 481797464     gbpln215.seq
 700947969     gbpln2150.se
 667672842     gbpln2151.se
 557142977     gbpln2152.se
 587023274     gbpln2153.se
 522955911     gbpln2154.se
 549261646     gbpln2155.se
    174960     gbpln2156.se
 555727736     gbpln2157.se
 707369547     gbpln2158.se
 665776881     gbpln2159.se
 185334309     gbpln216.seq
 632220444     gbpln2160.se
 603354746     gbpln2161.se
 512704100     gbpln2162.se
 209276730     gbpln2163.se
 542361412     gbpln2164.se
 673868938     gbpln2165.se
 669299626     gbpln2166.se
 594324003     gbpln2167.se
 633286407     gbpln2168.se
 540739103     gbpln2169.se
 332596046     gbpln217.seq
 656466500     gbpln2170.se
 573168484     gbpln2171.se
 664511655     gbpln2172.se
 699170489     gbpln2173.se
 613488890     gbpln2174.se
 604892488     gbpln2175.se
 530136173     gbpln2176.se
 321128187     gbpln2177.se
 549702443     gbpln2178.se
 691732891     gbpln2179.se
 352285419     gbpln218.seq
 690639525     gbpln2180.se
 592908220     gbpln2181.se
 583827820     gbpln2182.se
 505911951     gbpln2183.se
 187370785     gbpln2184.se
 531607726     gbpln2185.se
 670735982     gbpln2186.se
 639701218     gbpln2187.se
 625168916     gbpln2188.se
 608581292     gbpln2189.se
 316491733     gbpln219.seq
 409196174     gbpln2190.se
 650768736     gbpln2191.se
 553023979     gbpln2192.se
 701464510     gbpln2193.se
 681749344     gbpln2194.se
 628995544     gbpln2195.se
 631664938     gbpln2196.se
 532240293     gbpln2197.se
 701394148     gbpln2198.se
 563260621     gbpln2199.se
 458606826     gbpln22.seq
 356545945     gbpln220.seq
 694363863     gbpln2200.se
 602187920     gbpln2201.se
 534603645     gbpln2202.se
 623960566     gbpln2203.se
 400123881     gbpln2204.se
 659795356     gbpln2205.se
 548217914     gbpln2206.se
 710835335     gbpln2207.se
 630332153     gbpln2208.se
 576299747     gbpln2209.se
 237684058     gbpln221.seq
 601997530     gbpln2210.se
 504851755     gbpln2211.se
 628751564     gbpln2212.se
    175090     gbpln2213.se
 564528827     gbpln2214.se
 618979127     gbpln2215.se
 635231824     gbpln2216.se
 529924441     gbpln2217.se
 621986808     gbpln2218.se
 523379327     gbpln2219.se
 344675277     gbpln222.seq
 594649456     gbpln2220.se
 519615124     gbpln2221.se
 616668781     gbpln2222.se
 675038822     gbpln2223.se
 595433203     gbpln2224.se
 605474869     gbpln2225.se
 500671219     gbpln2226.se
 684971873     gbpln2227.se
 552386546     gbpln2228.se
 716306444     gbpln2229.se
 325130194     gbpln223.seq
 672179655     gbpln2230.se
 600740349     gbpln2231.se
 620624199     gbpln2232.se
 482434358     gbpln2233.se
 619293983     gbpln2234.se
 503654450     gbpln2235.se
 687554133     gbpln2236.se
 692658095     gbpln2237.se
 519573430     gbpln2238.se
 609582586     gbpln2239.se
 319807389     gbpln224.seq
 522424837     gbpln2240.se
 637977863     gbpln2241.se
    174958     gbpln2242.se
 814010732     gbpln2243.se
1048521841     gbpln2244.se
1038155649     gbpln2245.se
 833369914     gbpln2246.se
 931292853     gbpln2247.se
 811379776     gbpln2248.se
1004411700     gbpln2249.se
 320591842     gbpln225.seq
  73580987     gbpln2250.se
 812614241     gbpln2251.se
1052276437     gbpln2252.se
1035793500     gbpln2253.se
 832863065     gbpln2254.se
 922247149     gbpln2255.se
 807661511     gbpln2256.se
1004047797     gbpln2257.se
  62119261     gbpln2258.se
 537475227     gbpln2259.se
 370343519     gbpln226.seq
 460223025     gbpln2260.se
 693641164     gbpln2261.se
 580029100     gbpln2262.se
 597416510     gbpln2263.se
 505105364     gbpln2264.se
 657955597     gbpln2265.se
 551663040     gbpln2266.se
 470220012     gbpln2267.se
 640870217     gbpln2268.se
 550372651     gbpln2269.se
 226022854     gbpln227.seq
 609801478     gbpln2270.se
 526021655     gbpln2271.se
 679622534     gbpln2272.se
 554031927     gbpln2273.se
 683042768     gbpln2274.se
 659526432     gbpln2275.se
 583157115     gbpln2276.se
 580366358     gbpln2277.se
 500443859     gbpln2278.se
 672372455     gbpln2279.se
 487885129     gbpln228.seq
 554076188     gbpln2280.se
 701020945     gbpln2281.se
 648496395     gbpln2282.se
 568395035     gbpln2283.se
 607372526     gbpln2284.se
 532052842     gbpln2285.se
 684166413     gbpln2286.se
 494379648     gbpln2287.se
 488905431     gbpln2288.se
 443593696     gbpln2289.se
 488700928     gbpln229.seq
 447037980     gbpln2290.se
 486295927     gbpln2291.se
 489944647     gbpln2292.se
 120811847     gbpln2293.se
 445384194     gbpln2294.se
 486655806     gbpln2295.se
 436113233     gbpln2296.se
 414594212     gbpln2297.se
 458531282     gbpln2298.se
 454242911     gbpln2299.se
 465601747     gbpln23.seq
 471379021     gbpln230.seq
 489283288     gbpln2300.se
 468470878     gbpln2301.se
 467159933     gbpln2302.se
 405724963     gbpln2303.se
 141752273     gbpln2304.se
 475725974     gbpln2305.se
 490807512     gbpln2306.se
 465293781     gbpln2307.se
 464190576     gbpln2308.se
 499942611     gbpln2309.se
 474510233     gbpln231.seq
 485800833     gbpln2310.se
 412005073     gbpln2311.se
 438081540     gbpln2312.se
 494440209     gbpln2313.se
 487591848     gbpln2314.se
 388231814     gbpln2315.se
 239493380     gbpln2316.se
 454602157     gbpln2317.se
 491297089     gbpln2318.se
 486368814     gbpln2319.se
 273986841     gbpln232.seq
 489095838     gbpln2320.se
 475803306     gbpln2321.se
 492231886     gbpln2322.se
 334148590     gbpln2323.se
 498732770     gbpln2324.se
 422601321     gbpln2325.se
 489563882     gbpln2326.se
 466879977     gbpln2327.se
 403630469     gbpln2328.se
 201693354     gbpln2329.se
 413234155     gbpln233.seq
 425465420     gbpln2330.se
 148596170     gbpln2331.se
 221798426     gbpln2332.se
1908341558     gbpln2333.se
1899626925     gbpln2334.se
1507440270     gbpln2335.se
1195338085     gbpln2336.se
 871930698     gbpln2337.se
 491359468     gbpln2338.se
 421163895     gbpln2339.se
 425115149     gbpln234.seq
 489821939     gbpln2340.se
  56498931     gbpln2341.se
 469370229     gbpln2342.se
 494577090     gbpln2343.se
 459637310     gbpln2344.se
 428345494     gbpln2345.se
 471151788     gbpln2346.se
 498560271     gbpln2347.se
 496959342     gbpln2348.se
 488149774     gbpln2349.se
 425560692     gbpln235.seq
 496820963     gbpln2350.se
 256996209     gbpln2351.se
 457508500     gbpln2352.se
 462747609     gbpln2353.se
 489498695     gbpln2354.se
 409075226     gbpln2355.se
 778284082     gbpln2356.se
 627032043     gbpln2357.se
 971627123     gbpln2358.se
 850272715     gbpln2359.se
 753151986     gbpln236.seq
 849609082     gbpln2360.se
 850190924     gbpln2361.se
 976829654     gbpln2362.se
 814643125     gbpln2363.se
 879514342     gbpln2364.se
 812317704     gbpln2365.se
 742052286     gbpln2366.se
 746185007     gbpln2367.se
 944480603     gbpln2368.se
 877381912     gbpln2369.se
 744282264     gbpln237.seq
 418956047     gbpln2370.se
 379047469     gbpln2371.se
 491746997     gbpln2372.se
 408109925     gbpln2373.se
 411464498     gbpln2374.se
 405519448     gbpln2375.se
 421563263     gbpln2376.se
 486899328     gbpln2377.se
 448446966     gbpln2378.se
 468299962     gbpln2379.se
 743804521     gbpln238.seq
 498098635     gbpln2380.se
 328659405     gbpln2381.se
 397747269     gbpln2382.se
 349681340     gbpln2383.se
 412743518     gbpln2384.se
 308781250     gbpln2385.se
 220936514     gbpln2386.se
 362786573     gbpln2387.se
 372826577     gbpln2388.se
 389647645     gbpln2389.se
 739735479     gbpln239.seq
 356807036     gbpln2390.se
 423855958     gbpln2391.se
 318309373     gbpln2392.se
 224253502     gbpln2393.se
 357536065     gbpln2394.se
 499721839     gbpln2395.se
 373201666     gbpln2396.se
 487616772     gbpln2397.se
 443634648     gbpln2398.se
 444216942     gbpln2399.se
 494528875     gbpln24.seq
 667988546     gbpln240.seq
 324026933     gbpln2400.se
 302388084     gbpln2401.se
 306898966     gbpln2402.se
 275771316     gbpln2403.se
 274214478     gbpln2404.se
 282458958     gbpln2405.se
 242559643     gbpln2406.se
 249358523     gbpln2407.se
 475649908     gbpln2408.se
 456204313     gbpln2409.se
 650329544     gbpln241.seq
 395616203     gbpln2410.se
 489602228     gbpln2411.se
 289257941     gbpln2412.se
 288793337     gbpln2413.se
 275059682     gbpln2414.se
 268591783     gbpln2415.se
 268346034     gbpln2416.se
 286994965     gbpln2417.se
 262879986     gbpln2418.se
 458464803     gbpln2419.se
 574703572     gbpln242.seq
 455513152     gbpln2420.se
 390558841     gbpln2421.se
 198175855     gbpln2422.se
 311610770     gbpln2423.se
 305533406     gbpln2424.se
 289673508     gbpln2425.se
 286829600     gbpln2426.se
 256898846     gbpln2427.se
 268622309     gbpln2428.se
 256979800     gbpln2429.se
 490264012     gbpln243.seq
 492315386     gbpln2430.se
 408343937     gbpln2431.se
 399837733     gbpln2432.se
 356204441     gbpln2433.se
1225077527     gbpln2434.se
 720006493     gbpln2435.se
 919172194     gbpln2436.se
 874099561     gbpln2437.se
 897784196     gbpln2438.se
 876816853     gbpln2439.se
 430773005     gbpln244.seq
 928190368     gbpln2440.se
 951802003     gbpln2441.se
 824940722     gbpln2442.se
 760296712     gbpln2443.se
 729009749     gbpln2444.se
 725897595     gbpln2445.se
 714162060     gbpln2446.se
 661112453     gbpln2447.se
 467652752     gbpln2448.se
 493038138     gbpln2449.se
 494631260     gbpln245.seq
 304602931     gbpln2450.se
 498158027     gbpln2451.se
 481755962     gbpln2452.se
 420237390     gbpln2453.se
 375114024     gbpln2454.se
 482460500     gbpln2455.se
 443633499     gbpln2456.se
 499999935     gbpln2457.se
 464765931     gbpln2458.se
 434517734     gbpln246.seq
 494162266     gbpln247.seq
 469688145     gbpln248.seq
 488706817     gbpln249.seq
 426926678     gbpln25.seq
 497418943     gbpln250.seq
 381310794     gbpln251.seq
 460983181     gbpln252.seq
 455183610     gbpln253.seq
 477269031     gbpln254.seq
 487646183     gbpln255.seq
 467090611     gbpln256.seq
  71114034     gbpln257.seq
 495017956     gbpln258.seq
 460145370     gbpln259.seq
 224879017     gbpln26.seq
 499758825     gbpln260.seq
 480460294     gbpln261.seq
 357789591     gbpln262.seq
 495236494     gbpln263.seq
 338585381     gbpln264.seq
 445491347     gbpln265.seq
 499907826     gbpln266.seq
 169709069     gbpln267.seq
 484246438     gbpln268.seq
 457709024     gbpln269.seq
 369920299     gbpln27.seq
 491940182     gbpln270.seq
 445664088     gbpln271.seq
 453106454     gbpln272.seq
 138964454     gbpln273.seq
 462991476     gbpln274.seq
 493318599     gbpln275.seq
 494504946     gbpln276.seq
  45419007     gbpln277.seq
 626279429     gbpln278.seq
 818536598     gbpln279.seq
 320631792     gbpln28.seq
 744339771     gbpln280.seq
 840483636     gbpln281.seq
 794011180     gbpln282.seq
 688257643     gbpln283.seq
 841579594     gbpln284.seq
 496414302     gbpln285.seq
 479854160     gbpln286.seq
 440990924     gbpln287.seq
 475149874     gbpln288.seq
 492529207     gbpln289.seq
 318185493     gbpln29.seq
 460254850     gbpln290.seq
 434265022     gbpln291.seq
 486594471     gbpln292.seq
 435668408     gbpln293.seq
 493251190     gbpln294.seq
 480184778     gbpln295.seq
 277480565     gbpln296.seq
 480165306     gbpln297.seq
 459338903     gbpln298.seq
 482853354     gbpln299.seq
 499974223     gbpln3.seq
 320810750     gbpln30.seq
 489564507     gbpln300.seq
 490055303     gbpln301.seq
 342066317     gbpln302.seq
 492321474     gbpln303.seq
 474321265     gbpln304.seq
 482808661     gbpln305.seq
 498884306     gbpln306.seq
 499983012     gbpln307.seq
 277763314     gbpln308.seq
 487966613     gbpln309.seq
 339200181     gbpln31.seq
 489943528     gbpln310.seq
 494562566     gbpln311.seq
 476843997     gbpln312.seq
 457015521     gbpln313.seq
  71430896     gbpln314.seq
 429003094     gbpln315.seq
 458279570     gbpln316.seq
 488652569     gbpln317.seq
 557116302     gbpln318.seq
 564042982     gbpln319.seq
 222826757     gbpln32.seq
 565589046     gbpln320.seq
 598412524     gbpln321.seq
 651226985     gbpln322.seq
 669833733     gbpln323.seq
 251126055     gbpln324.seq
 481665756     gbpln325.seq
 315075338     gbpln326.seq
 428846882     gbpln327.seq
 458083406     gbpln328.seq
 488435218     gbpln329.seq
 336947956     gbpln33.seq
 556900270     gbpln330.seq
 563794885     gbpln331.seq
 565347445     gbpln332.seq
 598194649     gbpln333.seq
 650965037     gbpln334.seq
 669554729     gbpln335.seq
 475110216     gbpln336.seq
 407794053     gbpln337.seq
 432774718     gbpln338.seq
  99494863     gbpln339.seq
 309835203     gbpln34.seq
 443580780     gbpln340.seq
 480285834     gbpln341.seq
 359163047     gbpln342.seq
 457191780     gbpln343.seq
 406143837     gbpln344.seq
 436793969     gbpln345.seq
 459965743     gbpln346.seq
 467931651     gbpln347.seq
 471381035     gbpln348.seq
 479332584     gbpln349.seq
 351268105     gbpln35.seq
 251212563     gbpln350.seq
 458330600     gbpln351.seq
 485968877     gbpln352.seq
 477646524     gbpln353.seq
 442878481     gbpln354.seq
 494854700     gbpln355.seq
 411727448     gbpln356.seq
 466032484     gbpln357.seq
 478742350     gbpln358.seq
 479307889     gbpln359.seq
 492841594     gbpln36.seq
 472913638     gbpln360.seq
 498246978     gbpln361.seq
 398694105     gbpln362.seq
 498492071     gbpln363.seq
 468619495     gbpln364.seq
 446785917     gbpln365.seq
 463443515     gbpln366.seq
 364586957     gbpln367.seq
 481413942     gbpln368.seq
 453066758     gbpln369.seq
 497634304     gbpln37.seq
 499255637     gbpln370.seq
 411076712     gbpln371.seq
 311643879     gbpln372.seq
 456454550     gbpln373.seq
 393522953     gbpln374.seq
 368848942     gbpln375.seq
 352401561     gbpln376.seq
 334932373     gbpln377.seq
 464179868     gbpln378.seq
 133786016     gbpln379.seq
 490332825     gbpln38.seq
 480010844     gbpln380.seq
 499497049     gbpln381.seq
 491475622     gbpln382.seq
 441945654     gbpln383.seq
 491867038     gbpln384.seq
 463533213     gbpln385.seq
 474890759     gbpln386.seq
 468746954     gbpln387.seq
 484948080     gbpln388.seq
 419370759     gbpln389.seq
 419794317     gbpln39.seq
     86418     gbpln390.seq
    361751     gbpln391.seq
 164981114     gbpln392.seq
  40089516     gbpln393.seq
  74918158     gbpln394.seq
 499997847     gbpln395.seq
 360321581     gbpln396.seq
 499998459     gbpln397.seq
 499997970     gbpln398.seq
 144000020     gbpln399.seq
 499897802     gbpln4.seq
 472674201     gbpln40.seq
 499998217     gbpln400.seq
 499602722     gbpln401.seq
 499958424     gbpln402.seq
 291027751     gbpln403.seq
 298761380     gbpln404.seq
 211420757     gbpln405.seq
 248588960     gbpln406.seq
 185674454     gbpln407.seq
 997331398     gbpln408.seq
  56517854     gbpln409.seq
 500000131     gbpln41.seq
 487357680     gbpln410.seq
 473525596     gbpln411.seq
 473209473     gbpln412.seq
 467870653     gbpln413.seq
 168324953     gbpln414.seq
 442170645     gbpln415.seq
 460425795     gbpln416.seq
 479222672     gbpln417.seq
  92564056     gbpln418.seq
 609356119     gbpln419.seq
  25009408     gbpln42.seq
 786074578     gbpln420.seq
 733167229     gbpln421.seq
 736239733     gbpln422.seq
 691575746     gbpln423.seq
 660133963     gbpln424.seq
 739031764     gbpln425.seq
 457972634     gbpln426.seq
 425794743     gbpln427.seq
 499999929     gbpln428.seq
  66354013     gbpln429.seq
 346111820     gbpln43.seq
 499999389     gbpln430.seq
 500000118     gbpln431.seq
 272047862     gbpln432.seq
 499999458     gbpln433.seq
 499998922     gbpln434.seq
  93879111     gbpln435.seq
 499998888     gbpln436.seq
 484618299     gbpln437.seq
 499999618     gbpln438.seq
 421275702     gbpln439.seq
 384907647     gbpln44.seq
 499991352     gbpln440.seq
 391044897     gbpln441.seq
 499998947     gbpln442.seq
 499998491     gbpln443.seq
 499996057     gbpln444.seq
  72191740     gbpln445.seq
 499999086     gbpln446.seq
 499907369     gbpln447.seq
 423258403     gbpln448.seq
 499998405     gbpln449.seq
 205693142     gbpln45.seq
 499812432     gbpln450.seq
 497042128     gbpln451.seq
 489523740     gbpln452.seq
  88477255     gbpln453.seq
 499831885     gbpln454.seq
 491589683     gbpln455.seq
 402785639     gbpln456.seq
 445924319     gbpln457.seq
 499811150     gbpln458.seq
   5650012     gbpln459.seq
  85942873     gbpln46.seq
 492255134     gbpln460.seq
 226945063     gbpln461.seq
 315805316     gbpln462.seq
 665291577     gbpln463.seq
 860028189     gbpln464.seq
 800605872     gbpln465.seq
 794469115     gbpln466.seq
 762933697     gbpln467.seq
 729969959     gbpln468.seq
 808217924     gbpln469.seq
 477916829     gbpln47.seq
 209360455     gbpln470.seq
 924325157     gbpln471.seq
1201978654     gbpln472.seq
1227268207     gbpln473.seq
1152253241     gbpln474.seq
1115248374     gbpln475.seq
1125506105     gbpln476.seq
1145303472     gbpln477.seq
 695608615     gbpln478.seq
 494750269     gbpln479.seq
 499904224     gbpln48.seq
 460644363     gbpln480.seq
 152680390     gbpln481.seq
 462987281     gbpln482.seq
 480457520     gbpln483.seq
 494737040     gbpln484.seq
 446441302     gbpln485.seq
 117077133     gbpln486.seq
 485280656     gbpln487.seq
 153318246     gbpln488.seq
 689933987     gbpln489.seq
 498817817     gbpln49.seq
 887561680     gbpln490.seq
 834970472     gbpln491.seq
 826391913     gbpln492.seq
 792513917     gbpln493.seq
 743209872     gbpln494.seq
 833073712     gbpln495.seq
    562407     gbpln496.seq
 665291577     gbpln497.seq
 860028189     gbpln498.seq
 800605872     gbpln499.seq
 480121205     gbpln5.seq
 323729344     gbpln50.seq
 794469115     gbpln500.seq
 762933697     gbpln501.seq
 729969959     gbpln502.seq
 808217924     gbpln503.seq
 189172290     gbpln504.seq
 663098252     gbpln505.seq
 855592604     gbpln506.seq
 807031053     gbpln507.seq
 793905039     gbpln508.seq
 773303164     gbpln509.seq
 499081471     gbpln51.seq
 718153248     gbpln510.seq
 804870210     gbpln511.seq
 661762125     gbpln512.seq
 840180304     gbpln513.seq
 796430245     gbpln514.seq
 779180715     gbpln515.seq
 761224530     gbpln516.seq
 725380245     gbpln517.seq
 792983451     gbpln518.seq
 652402241     gbpln519.seq
 497391852     gbpln52.seq
 831209396     gbpln520.seq
 783682955     gbpln521.seq
 775938782     gbpln522.seq
 741958804     gbpln523.seq
 700440901     gbpln524.seq
 788705159     gbpln525.seq
 683172483     gbpln526.seq
 872662143     gbpln527.seq
 815663229     gbpln528.seq
 813528167     gbpln529.seq
 499428423     gbpln53.seq
 780491844     gbpln530.seq
 734904793     gbpln531.seq
 816941948     gbpln532.seq
 635039454     gbpln533.seq
 824184474     gbpln534.seq
 768070182     gbpln535.seq
 758956882     gbpln536.seq
 732189331     gbpln537.seq
 706311232     gbpln538.seq
 766293442     gbpln539.seq
 103294748     gbpln54.seq
 651415133     gbpln540.seq
 830082304     gbpln541.seq
 783385752     gbpln542.seq
 770520351     gbpln543.seq
 753421970     gbpln544.seq
 699441547     gbpln545.seq
 784443196     gbpln546.seq
      4698     gbpln547.seq
 702337808     gbpln548.seq
 906907390     gbpln549.seq
 496567059     gbpln55.seq
 844110716     gbpln550.seq
 841780855     gbpln551.seq
 805270043     gbpln552.seq
 764396863     gbpln553.seq
 841492595     gbpln554.seq
 714482811     gbpln555.seq
 916127997     gbpln556.seq
 858459407     gbpln557.seq
 848936990     gbpln558.seq
 813129213     gbpln559.seq
 478891417     gbpln56.seq
 765593150     gbpln560.seq
 862731158     gbpln561.seq
 665885634     gbpln562.seq
 854365265     gbpln563.seq
 802776346     gbpln564.seq
 793295912     gbpln565.seq
 769246240     gbpln566.seq
 710912919     gbpln567.seq
 799876815     gbpln568.seq
 629668050     gbpln569.seq
 383840468     gbpln57.seq
 814320946     gbpln570.seq
 759349720     gbpln571.seq
 762512207     gbpln572.seq
 724647884     gbpln573.seq
 679679449     gbpln574.seq
 784312844     gbpln575.seq
 684180819     gbpln576.seq
 873292213     gbpln577.seq
 827422505     gbpln578.seq
 815925825     gbpln579.seq
 454048257     gbpln58.seq
 779009585     gbpln580.seq
 739747654     gbpln581.seq
 834950434     gbpln582.seq
 663096073     gbpln583.seq
 849628701     gbpln584.seq
 803882830     gbpln585.seq
 794420470     gbpln586.seq
 760127459     gbpln587.seq
 714663802     gbpln588.seq
 801095950     gbpln589.seq
 495221947     gbpln59.seq
 668869887     gbpln590.seq
 854770002     gbpln591.seq
 805931576     gbpln592.seq
 798923954     gbpln593.seq
 766411223     gbpln594.seq
 723133936     gbpln595.seq
 803351408     gbpln596.seq
 664176987     gbpln597.seq
 854339916     gbpln598.seq
 803900400     gbpln599.seq
 499999166     gbpln6.seq
 486126589     gbpln60.seq
 791449620     gbpln600.seq
 761145205     gbpln601.seq
 715062603     gbpln602.seq
 806379176     gbpln603.seq
 668964953     gbpln604.seq
 870939392     gbpln605.seq
 809408813     gbpln606.seq
 801514137     gbpln607.seq
 768794024     gbpln608.seq
 723644689     gbpln609.seq
 498663354     gbpln61.seq
 815153418     gbpln610.seq
 661177159     gbpln611.seq
 846934671     gbpln612.seq
 794708793     gbpln613.seq
 789781753     gbpln614.seq
 764576068     gbpln615.seq
 711115451     gbpln616.seq
 797517245     gbpln617.seq
 691953899     gbpln618.seq
 888406351     gbpln619.seq
 471931537     gbpln62.seq
 835271741     gbpln620.seq
 823533989     gbpln621.seq
 787819193     gbpln622.seq
 748786657     gbpln623.seq
 838184652     gbpln624.seq
 488802687     gbpln625.seq
 439661491     gbpln626.seq
 155752105     gbpln627.seq
 758806100     gbpln628.seq
 898446949     gbpln629.seq
 497321530     gbpln63.seq
 628489896     gbpln630.seq
1024113089     gbpln631.seq
1032878661     gbpln632.seq
 858694781     gbpln633.seq
 960391204     gbpln634.seq
1090094606     gbpln635.seq
 781959143     gbpln636.seq
 946995961     gbpln637.seq
 857542781     gbpln638.seq
 656405285     gbpln639.seq
 472649872     gbpln64.seq
 907889097     gbpln640.seq
 896386890     gbpln641.seq
 726432335     gbpln642.seq
 798296822     gbpln643.seq
 918393750     gbpln644.seq
 584961784     gbpln645.seq
 948865971     gbpln646.seq
 954536271     gbpln647.seq
 819735731     gbpln648.seq
 756588093     gbpln649.seq
 478648821     gbpln65.seq
 876067119     gbpln650.seq
 625446321     gbpln651.seq
 977801494     gbpln652.seq
 854357980     gbpln653.seq
 807732556     gbpln654.seq
 947696453     gbpln655.seq
1067629605     gbpln656.seq
 822222048     gbpln657.seq
 950272996     gbpln658.seq
 845138843     gbpln659.seq
  83738365     gbpln66.seq
 643846993     gbpln660.seq
 894745096     gbpln661.seq
 893352134     gbpln662.seq
 722578984     gbpln663.seq
 776227316     gbpln664.seq
 899750467     gbpln665.seq
 592059964     gbpln666.seq
 933986451     gbpln667.seq
 939527664     gbpln668.seq
 810117922     gbpln669.seq
 494334107     gbpln67.seq
 765938558     gbpln670.seq
 886537018     gbpln671.seq
 623519964     gbpln672.seq
 996940649     gbpln673.seq
1030190034     gbpln674.seq
 832828033     gbpln675.seq
 956342979     gbpln676.seq
1134286144     gbpln677.seq
 790513299     gbpln678.seq
 944161893     gbpln679.seq
 475215142     gbpln68.seq
 860035788     gbpln680.seq
 647268685     gbpln681.seq
 902239623     gbpln682.seq
 611029440     gbpln683.seq
 734907577     gbpln684.seq
 787834228     gbpln685.seq
 910724363     gbpln686.seq
 606016896     gbpln687.seq
 961485234     gbpln688.seq
1242775191     gbpln689.seq
 468208544     gbpln69.seq
 816670128     gbpln690.seq
 636658925     gbpln691.seq
 818591771     gbpln692.seq
 766580884     gbpln693.seq
 752100829     gbpln694.seq
 724519993     gbpln695.seq
 690955648     gbpln696.seq
 769738288     gbpln697.seq
 750738544     gbpln698.seq
 872184389     gbpln699.seq
 499939641     gbpln7.seq
 486860731     gbpln70.seq
 624480879     gbpln700.seq
 995069022     gbpln701.seq
1012956234     gbpln702.seq
 827074347     gbpln703.seq
 940621783     gbpln704.seq
1079418810     gbpln705.seq
 776922106     gbpln706.seq
 938380968     gbpln707.seq
 848757671     gbpln708.seq
 643572913     gbpln709.seq
 272302955     gbpln71.seq
 891714442     gbpln710.seq
 878638403     gbpln711.seq
 721632671     gbpln712.seq
 779156122     gbpln713.seq
 895553446     gbpln714.seq
 604678568     gbpln715.seq
 931006295     gbpln716.seq
 933660027     gbpln717.seq
 810459540     gbpln718.seq
 761872100     gbpln719.seq
 172902228     gbpln72.seq
 878702815     gbpln720.seq
 627081460     gbpln721.seq
 994320235     gbpln722.seq
 999434327     gbpln723.seq
 823789349     gbpln724.seq
 945629782     gbpln725.seq
1062113821     gbpln726.seq
 792298939     gbpln727.seq
 941851700     gbpln728.seq
 850142413     gbpln729.seq
 471233536     gbpln73.seq
 656955691     gbpln730.seq
 904094753     gbpln731.seq
 900193903     gbpln732.seq
 728906821     gbpln733.seq
 741172650     gbpln734.seq
 898719079     gbpln735.seq
 599002526     gbpln736.seq
 937117048     gbpln737.seq
 936021119     gbpln738.seq
 812696702     gbpln739.seq
 455042321     gbpln74.seq
 746628212     gbpln740.seq
 897168807     gbpln741.seq
 626698501     gbpln742.seq
1007072101     gbpln743.seq
1000831797     gbpln744.seq
 841918855     gbpln745.seq
 963426816     gbpln746.seq
1093654114     gbpln747.seq
 791118382     gbpln748.seq
 959940756     gbpln749.seq
 488809223     gbpln75.seq
 853263842     gbpln750.seq
 648051398     gbpln751.seq
 901282075     gbpln752.seq
 923491092     gbpln753.seq
 732477869     gbpln754.seq
 789987733     gbpln755.seq
 926022053     gbpln756.seq
 610840579     gbpln757.seq
 949759032     gbpln758.seq
 955444559     gbpln759.seq
 355272263     gbpln76.seq
 818480442     gbpln760.seq
 752251380     gbpln761.seq
 897893149     gbpln762.seq
 631111272     gbpln763.seq
1022032953     gbpln764.seq
1006306956     gbpln765.seq
 837035085     gbpln766.seq
 966140819     gbpln767.seq
1090560006     gbpln768.seq
 800164754     gbpln769.seq
 200538454     gbpln77.seq
 959884028     gbpln770.seq
 886916735     gbpln771.seq
 641540050     gbpln772.seq
 910168783     gbpln773.seq
 908785549     gbpln774.seq
 729527181     gbpln775.seq
 797552105     gbpln776.seq
 910975470     gbpln777.seq
 616026199     gbpln778.seq
 945685366     gbpln779.seq
 377219536     gbpln78.seq
 953145956     gbpln780.seq
 820081609     gbpln781.seq
 763165947     gbpln782.seq
 870898266     gbpln783.seq
 618200825     gbpln784.seq
1009123187     gbpln785.seq
1016689515     gbpln786.seq
 832912303     gbpln787.seq
 952656374     gbpln788.seq
1065835283     gbpln789.seq
 375192640     gbpln79.seq
 776075044     gbpln790.seq
 935940025     gbpln791.seq
 846831932     gbpln792.seq
 641399988     gbpln793.seq
 892709705     gbpln794.seq
 594848385     gbpln795.seq
 720169483     gbpln796.seq
 780564861     gbpln797.seq
 888344689     gbpln798.seq
 610800072     gbpln799.seq
 226151695     gbpln8.seq
 386441749     gbpln80.seq
 934713391     gbpln800.seq
1233388213     gbpln801.seq
 807523234     gbpln802.seq
     19542     gbpln803.seq
 757881986     gbpln804.seq
 889760627     gbpln805.seq
 635890046     gbpln806.seq
1007873898     gbpln807.seq
1015524558     gbpln808.seq
 836625022     gbpln809.seq
 475314026     gbpln81.seq
 959076059     gbpln810.seq
1077416379     gbpln811.seq
 789416089     gbpln812.seq
 958430056     gbpln813.seq
 877922843     gbpln814.seq
 648665455     gbpln815.seq
 907513209     gbpln816.seq
 904978028     gbpln817.seq
 727024880     gbpln818.seq
 789120540     gbpln819.seq
 452882572     gbpln82.seq
 898507915     gbpln820.seq
 617229811     gbpln821.seq
 942711764     gbpln822.seq
 964780021     gbpln823.seq
 818917331     gbpln824.seq
 755294557     gbpln825.seq
 882064051     gbpln826.seq
 627203691     gbpln827.seq
 993595919     gbpln828.seq
1021497440     gbpln829.seq
 125944249     gbpln83.seq
 827286497     gbpln830.seq
 962451301     gbpln831.seq
1082256067     gbpln832.seq
 781463827     gbpln833.seq
 919665368     gbpln834.seq
 852133929     gbpln835.seq
 645388382     gbpln836.seq
 905574854     gbpln837.seq
 906714977     gbpln838.seq
 718743537     gbpln839.seq
 476593700     gbpln84.seq
 787529633     gbpln840.seq
 910251919     gbpln841.seq
 608518276     gbpln842.seq
 934541265     gbpln843.seq
 954054955     gbpln844.seq
 806443717     gbpln845.seq
1009766480     gbpln846.seq
1318260463     gbpln847.seq
1253136609     gbpln848.seq
1066198175     gbpln849.seq
 434249982     gbpln85.seq
1119572655     gbpln850.seq
1040217505     gbpln851.seq
1310077288     gbpln852.seq
 955690374     gbpln853.seq
1230684440     gbpln854.seq
1179787958     gbpln855.seq
1125383520     gbpln856.seq
1051194518     gbpln857.seq
 965656648     gbpln858.seq
1110281977     gbpln859.seq
 440487400     gbpln86.seq
     32675     gbpln860.seq
 253174917     gbpln861.seq
 654245898     gbpln862.seq
 843080362     gbpln863.seq
 787261705     gbpln864.seq
 773098599     gbpln865.seq
 745082094     gbpln866.seq
 711612756     gbpln867.seq
 801222610     gbpln868.seq
    271156     gbpln869.seq
 444203819     gbpln87.seq
 398651709     gbpln870.seq
 315170317     gbpln871.seq
 306732013     gbpln872.seq
 319872292     gbpln873.seq
 286450423     gbpln874.seq
 220883441     gbpln875.seq
 470283415     gbpln876.seq
 475876375     gbpln877.seq
 499130261     gbpln878.seq
 460644363     gbpln879.seq
 189178972     gbpln88.seq
 359155255     gbpln880.seq
 399402445     gbpln881.seq
 501115666     gbpln882.seq
 413826113     gbpln883.seq
 367000227     gbpln884.seq
 238050627     gbpln885.seq
 352241749     gbpln886.seq
 298781185     gbpln887.seq
 490717667     gbpln888.seq
  86108252     gbpln889.seq
 460469435     gbpln89.seq
   9838016     gbpln890.seq
  10168231     gbpln891.seq
 766528189     gbpln892.seq
 422668596     gbpln893.seq
 133601533     gbpln894.seq
 756143249     gbpln895.seq
 878426054     gbpln896.seq
 631056251     gbpln897.seq
 993852367     gbpln898.seq
1020132695     gbpln899.seq
 500000209     gbpln9.seq
 440542307     gbpln90.seq
 830166807     gbpln900.seq
 955723315     gbpln901.seq
1057964328     gbpln902.seq
 784007552     gbpln903.seq
 947940191     gbpln904.seq
 857511193     gbpln905.seq
 649137171     gbpln906.seq
 903393879     gbpln907.seq
 908180396     gbpln908.seq
 721135945     gbpln909.seq
 452992006     gbpln91.seq
 786739709     gbpln910.seq
 918070756     gbpln911.seq
 603192844     gbpln912.seq
 938102555     gbpln913.seq
 955978436     gbpln914.seq
 813787878     gbpln915.seq
 639701128     gbpln916.seq
 468552999     gbpln917.seq
 499475514     gbpln918.seq
 498586280     gbpln919.seq
 497916786     gbpln92.seq
  20795939     gbpln920.seq
 768129678     gbpln921.seq
 891209633     gbpln922.seq
1017177961     gbpln923.seq
1036708108     gbpln924.seq
 980496603     gbpln925.seq
1096870510     gbpln926.seq
 964601805     gbpln927.seq
 883690282     gbpln928.seq
 879367269     gbpln929.seq
 452560860     gbpln93.seq
 922136688     gbpln930.seq
 805432021     gbpln931.seq
 912345991     gbpln932.seq
 954500353     gbpln933.seq
 944560088     gbpln934.seq
  29543025     gbpln935.seq
 404689567     gbpln936.seq
 499997587     gbpln937.seq
 499998682     gbpln938.seq
 488964703     gbpln939.seq
 363117062     gbpln94.seq
 499998605     gbpln940.seq
 499813392     gbpln941.seq
 499999553     gbpln942.seq
  90185297     gbpln943.seq
 499998058     gbpln944.seq
 499927227     gbpln945.seq
 500000022     gbpln946.seq
 326707114     gbpln947.seq
 499748088     gbpln948.seq
 499974021     gbpln949.seq
 495372504     gbpln95.seq
 499993366     gbpln950.seq
  32336415     gbpln951.seq
 499815407     gbpln952.seq
 499858822     gbpln953.seq
 499754197     gbpln954.seq
 174267451     gbpln955.seq
 499999366     gbpln956.seq
 499941807     gbpln957.seq
 499982638     gbpln958.seq
 499998007     gbpln959.seq
 472129613     gbpln96.seq
 499820155     gbpln960.seq
 136492608     gbpln961.seq
 499814172     gbpln962.seq
 499886617     gbpln963.seq
 499589726     gbpln964.seq
 412005104     gbpln965.seq
 499990243     gbpln966.seq
 499820681     gbpln967.seq
 499953608     gbpln968.seq
 499833936     gbpln969.seq
 477884160     gbpln97.seq
  84989104     gbpln970.seq
 499939778     gbpln971.seq
 499999054     gbpln972.seq
 499905893     gbpln973.seq
 291631209     gbpln974.seq
 499889165     gbpln975.seq
 499999991     gbpln976.seq
 499882980     gbpln977.seq
 485173945     gbpln978.seq
 315191996     gbpln979.seq
 460004048     gbpln98.seq
 674055631     gbpln980.seq
 865045961     gbpln981.seq
 815791689     gbpln982.seq
 802718902     gbpln983.seq
 776304595     gbpln984.seq
 721531499     gbpln985.seq
 809857060     gbpln986.seq
 679344023     gbpln987.seq
 873797632     gbpln988.seq
 820367220     gbpln989.seq
 430418757     gbpln99.seq
 806296382     gbpln990.seq
 775209384     gbpln991.seq
 744231520     gbpln992.seq
 817156402     gbpln993.seq
 771380170     gbpln994.seq
 913253142     gbpln995.seq
 634934982     gbpln996.seq
1019175188     gbpln997.seq
1023638564     gbpln998.seq
 822225605     gbpln999.seq
 148373644     gbpri1.seq
 499825465     gbpri10.seq
 499966274     gbpri11.seq
 248882813     gbpri12.seq
 499849548     gbpri13.seq
 352979039     gbpri14.seq
 162643079     gbpri15.seq
 494712989     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962231     gbpri19.seq
 499849640     gbpri2.seq
 254317986     gbpri20.seq
 317623611     gbpri21.seq
 301999314     gbpri22.seq
 491210460     gbpri23.seq
 445784960     gbpri24.seq
 381564599     gbpri25.seq
 343180411     gbpri26.seq
 476587789     gbpri27.seq
 474072403     gbpri28.seq
 368094098     gbpri29.seq
 499891275     gbpri3.seq
 499998059     gbpri30.seq
  73923753     gbpri31.seq
 499936200     gbpri32.seq
 445709575     gbpri33.seq
 427947001     gbpri34.seq
 376529642     gbpri35.seq
 483909975     gbpri36.seq
 361488390     gbpri37.seq
 388660134     gbpri38.seq
 448630862     gbpri39.seq
 499855408     gbpri4.seq
 499942041     gbpri40.seq
 307422469     gbpri41.seq
 314630532     gbpri42.seq
 470160481     gbpri43.seq
 368030827     gbpri44.seq
 425225490     gbpri45.seq
 474922500     gbpri46.seq
 254728483     gbpri47.seq
 434253471     gbpri48.seq
 470466014     gbpri49.seq
 499729176     gbpri5.seq
 448364439     gbpri50.seq
 281198579     gbpri51.seq
 340509118     gbpri52.seq
 417831330     gbpri53.seq
 388737343     gbpri54.seq
 460172605     gbpri55.seq
 498945852     gbpri56.seq
 425127193     gbpri57.seq
  84915826     gbpri58.seq
 499325712     gbpri59.seq
 393528728     gbpri6.seq
 481986671     gbpri60.seq
 477279859     gbpri61.seq
 486297556     gbpri62.seq
 434085555     gbpri63.seq
 486584425     gbpri64.seq
 353370715     gbpri65.seq
 333458839     gbpri66.seq
 419262080     gbpri67.seq
 486067692     gbpri68.seq
 473340709     gbpri69.seq
 499802910     gbpri7.seq
 257299879     gbpri70.seq
 500000080     gbpri71.seq
 499986578     gbpri72.seq
 235617103     gbpri73.seq
 499999782     gbpri74.seq
 499997086     gbpri75.seq
 316411730     gbpri76.seq
 499989738     gbpri77.seq
 499999210     gbpri78.seq
 328917948     gbpri79.seq
 499984899     gbpri8.seq
 258775295     gbpri80.seq
 499996627     gbpri81.seq
 499998772     gbpri82.seq
 372268619     gbpri83.seq
 499969779     gbpri84.seq
 499986502     gbpri85.seq
 499974586     gbpri86.seq
   9963313     gbpri87.seq
 499967070     gbpri9.seq
   1435813     gbrel.txt
 499951536     gbrod1.seq
 499998574     gbrod10.seq
 419878182     gbrod100.seq
 403492494     gbrod101.seq
 439526332     gbrod102.seq
 248164111     gbrod103.seq
 405939473     gbrod104.seq
 384447340     gbrod105.seq
 355679333     gbrod106.seq
 497729616     gbrod107.seq
 445498035     gbrod108.seq
 466416387     gbrod109.seq
   6033902     gbrod11.seq
 384594494     gbrod110.seq
 370764567     gbrod111.seq
 352341932     gbrod112.seq
 472534897     gbrod113.seq
 442899850     gbrod114.seq
 391247240     gbrod115.seq
 302308728     gbrod116.seq
 480858122     gbrod117.seq
 424097302     gbrod118.seq
 389168953     gbrod119.seq
 499806176     gbrod12.seq
 364557408     gbrod120.seq
 496236266     gbrod121.seq
 457035537     gbrod122.seq
 397907216     gbrod123.seq
 303919253     gbrod124.seq
 472719372     gbrod125.seq
 199611566     gbrod126.seq
 379735208     gbrod127.seq
 373874236     gbrod128.seq
 492612107     gbrod129.seq
 203924668     gbrod13.seq
 455685049     gbrod130.seq
 424015225     gbrod131.seq
 422109961     gbrod132.seq
 402489078     gbrod133.seq
 150585215     gbrod134.seq
 432875924     gbrod135.seq
 473809988     gbrod136.seq
 493341944     gbrod137.seq
 369899434     gbrod138.seq
 352286248     gbrod139.seq
 499996808     gbrod14.seq
 495134062     gbrod140.seq
 469349893     gbrod141.seq
 385134441     gbrod142.seq
 370752989     gbrod143.seq
 350782953     gbrod144.seq
 472215298     gbrod145.seq
 440418647     gbrod146.seq
 390673256     gbrod147.seq
 299732413     gbrod148.seq
 469102685     gbrod149.seq
 499997002     gbrod15.seq
 389834819     gbrod150.seq
 372942018     gbrod151.seq
 357041751     gbrod152.seq
 471802981     gbrod153.seq
 442335356     gbrod154.seq
 272062219     gbrod155.seq
 421368094     gbrod156.seq
 465159875     gbrod157.seq
 385490257     gbrod158.seq
 365814425     gbrod159.seq
 499998793     gbrod16.seq
 349038378     gbrod160.seq
 318450016     gbrod161.seq
 448518533     gbrod162.seq
 413714740     gbrod163.seq
 419290195     gbrod164.seq
 466211866     gbrod165.seq
 387893635     gbrod166.seq
 186742583     gbrod167.seq
 369103842     gbrod168.seq
 487915723     gbrod169.seq
 296354483     gbrod17.seq
 450102561     gbrod170.seq
 413892753     gbrod171.seq
 419378521     gbrod172.seq
 249506719     gbrod173.seq
 431031986     gbrod174.seq
 392811039     gbrod175.seq
 374963024     gbrod176.seq
 339853098     gbrod177.seq
 465902366     gbrod178.seq
 448509046     gbrod179.seq
 416932044     gbrod18.seq
 478088985     gbrod180.seq
  74225189     gbrod181.seq
 401026287     gbrod182.seq
 438450513     gbrod183.seq
 392223411     gbrod184.seq
 298791488     gbrod185.seq
 421037306     gbrod186.seq
 377024222     gbrod187.seq
 358182039     gbrod188.seq
 498127194     gbrod189.seq
 485622431     gbrod19.seq
 395007403     gbrod190.seq
 420940299     gbrod191.seq
 420418108     gbrod192.seq
 416033149     gbrod193.seq
 371638158     gbrod194.seq
 168940443     gbrod195.seq
 344507393     gbrod196.seq
 318954535     gbrod197.seq
 344554082     gbrod198.seq
 342695770     gbrod199.seq
 499801667     gbrod2.seq
 447177606     gbrod20.seq
 464792186     gbrod200.seq
 401018426     gbrod201.seq
 244981400     gbrod202.seq
 424020455     gbrod203.seq
 445077763     gbrod204.seq
 471066620     gbrod205.seq
 463756029     gbrod206.seq
 477523791     gbrod207.seq
 429214893     gbrod208.seq
 482809898     gbrod209.seq
 401874104     gbrod21.seq
 409881666     gbrod210.seq
 499005744     gbrod211.seq
 445425390     gbrod212.seq
 453009972     gbrod213.seq
 238222178     gbrod214.seq
 433121687     gbrod215.seq
 401444461     gbrod216.seq
 355166120     gbrod217.seq
 439733945     gbrod218.seq
 399262915     gbrod219.seq
 366906621     gbrod22.seq
 343303814     gbrod220.seq
 449604401     gbrod221.seq
 373291356     gbrod222.seq
 491021867     gbrod223.seq
 411878942     gbrod224.seq
 394783112     gbrod225.seq
 354215147     gbrod226.seq
 478827549     gbrod227.seq
 464689320     gbrod228.seq
 496457781     gbrod229.seq
 178573599     gbrod23.seq
 328639335     gbrod230.seq
 429295912     gbrod231.seq
 201904361     gbrod232.seq
 381229576     gbrod233.seq
 352252100     gbrod234.seq
 483911001     gbrod235.seq
 439271128     gbrod236.seq
 432391884     gbrod237.seq
 379422136     gbrod238.seq
 487314628     gbrod239.seq
 488460696     gbrod24.seq
 424101431     gbrod240.seq
 402251656     gbrod241.seq
 377306384     gbrod242.seq
 496030481     gbrod243.seq
 476084602     gbrod244.seq
 404173831     gbrod245.seq
 121703297     gbrod246.seq
 471718554     gbrod247.seq
 429849644     gbrod248.seq
 369205357     gbrod249.seq
 424418862     gbrod25.seq
 458471717     gbrod250.seq
 410175604     gbrod251.seq
 423146610     gbrod252.seq
 172228268     gbrod253.seq
 492401067     gbrod254.seq
 487467397     gbrod255.seq
 412574887     gbrod256.seq
 371643290     gbrod257.seq
 458445658     gbrod258.seq
 395932157     gbrod259.seq
 451727059     gbrod26.seq
 429793810     gbrod260.seq
 490297286     gbrod261.seq
 410121996     gbrod262.seq
 409184503     gbrod263.seq
 367837774     gbrod264.seq
 447381136     gbrod265.seq
 223327565     gbrod266.seq
 402425622     gbrod267.seq
 448449857     gbrod268.seq
 461815006     gbrod269.seq
 499112036     gbrod27.seq
 478700924     gbrod270.seq
 408314221     gbrod271.seq
 349093340     gbrod272.seq
 455227074     gbrod273.seq
 454883295     gbrod274.seq
 483614724     gbrod275.seq
 369373092     gbrod276.seq
 442583968     gbrod277.seq
 421061266     gbrod278.seq
 196273488     gbrod279.seq
 467946548     gbrod28.seq
 350815101     gbrod280.seq
 431195894     gbrod281.seq
 436876327     gbrod282.seq
 495700637     gbrod283.seq
 383320388     gbrod284.seq
 457101351     gbrod285.seq
 410386577     gbrod286.seq
 373894312     gbrod287.seq
 447245565     gbrod288.seq
 442554857     gbrod289.seq
 425428799     gbrod29.seq
 496529716     gbrod290.seq
 438732151     gbrod291.seq
 404017310     gbrod292.seq
 417018539     gbrod293.seq
 194574877     gbrod294.seq
 493375331     gbrod295.seq
 407058545     gbrod296.seq
 420360712     gbrod297.seq
 497137694     gbrod298.seq
 376315111     gbrod299.seq
 499860799     gbrod3.seq
 380509124     gbrod30.seq
 435156107     gbrod300.seq
 487765053     gbrod301.seq
 406428098     gbrod302.seq
 448028858     gbrod303.seq
 469164401     gbrod304.seq
 471219154     gbrod305.seq
 251509050     gbrod306.seq
 303883779     gbrod307.seq
 469719503     gbrod308.seq
 386750689     gbrod309.seq
 359291146     gbrod31.seq
 495403498     gbrod310.seq
 440414980     gbrod311.seq
 405968892     gbrod312.seq
 477306463     gbrod313.seq
 337532140     gbrod314.seq
 462256366     gbrod315.seq
 415376279     gbrod316.seq
 492229021     gbrod317.seq
 123278654     gbrod318.seq
 496959769     gbrod319.seq
 441031541     gbrod32.seq
 479839682     gbrod320.seq
 488921167     gbrod321.seq
 491723007     gbrod322.seq
 280003390     gbrod323.seq
 411886297     gbrod324.seq
 462247794     gbrod325.seq
 498359150     gbrod326.seq
 488306432     gbrod327.seq
 487425220     gbrod328.seq
 493682332     gbrod329.seq
 489661762     gbrod33.seq
 493124496     gbrod330.seq
 465223215     gbrod331.seq
 454737651     gbrod332.seq
 464631644     gbrod333.seq
 472206295     gbrod334.seq
 254113502     gbrod335.seq
 439091843     gbrod336.seq
 415353898     gbrod337.seq
 369082913     gbrod338.seq
 455254536     gbrod339.seq
 301541840     gbrod34.seq
 401064112     gbrod340.seq
 431845684     gbrod341.seq
 459347562     gbrod342.seq
 162402725     gbrod343.seq
 245696968     gbrod35.seq
 444533522     gbrod36.seq
 404901396     gbrod37.seq
 350079181     gbrod38.seq
 484303888     gbrod39.seq
 499965631     gbrod4.seq
 464197213     gbrod40.seq
 475600609     gbrod41.seq
 417011576     gbrod42.seq
 368092577     gbrod43.seq
 459234406     gbrod44.seq
 385583012     gbrod45.seq
 488265022     gbrod46.seq
 434197329     gbrod47.seq
 412800312     gbrod48.seq
 454365663     gbrod49.seq
 499960342     gbrod5.seq
 382748472     gbrod50.seq
 428038719     gbrod51.seq
 487918369     gbrod52.seq
 440586747     gbrod53.seq
 359290553     gbrod54.seq
 499999709     gbrod55.seq
 307922789     gbrod56.seq
 390007635     gbrod57.seq
 346418766     gbrod58.seq
 345548222     gbrod59.seq
  80291490     gbrod6.seq
 465925928     gbrod60.seq
 403537722     gbrod61.seq
 386823577     gbrod62.seq
 403462511     gbrod63.seq
 391812927     gbrod64.seq
 346719868     gbrod65.seq
 491742089     gbrod66.seq
 445010312     gbrod67.seq
 493387550     gbrod68.seq
 300864949     gbrod69.seq
 499846851     gbrod7.seq
 466768965     gbrod70.seq
 374387663     gbrod71.seq
 350248940     gbrod72.seq
 470230178     gbrod73.seq
 465917437     gbrod74.seq
 493546372     gbrod75.seq
 164945760     gbrod76.seq
 403745653     gbrod77.seq
 436915885     gbrod78.seq
 473498938     gbrod79.seq
 499742719     gbrod8.seq
 494867130     gbrod80.seq
 353125249     gbrod81.seq
 339090141     gbrod82.seq
 372648418     gbrod83.seq
 304437664     gbrod84.seq
 466850317     gbrod85.seq
 387285794     gbrod86.seq
 374061084     gbrod87.seq
 353646449     gbrod88.seq
 160857005     gbrod89.seq
 499945822     gbrod9.seq
 461956462     gbrod90.seq
 433837684     gbrod91.seq
 474478559     gbrod92.seq
 316311284     gbrod93.seq
 418985554     gbrod94.seq
 371050540     gbrod95.seq
 363244189     gbrod96.seq
 482685615     gbrod97.seq
 448001147     gbrod98.seq
 413360145     gbrod99.seq
 499999658     gbsts1.seq
 499999261     gbsts10.seq
 433593483     gbsts11.seq
 499999583     gbsts2.seq
  38293156     gbsts3.seq
 499998792     gbsts4.seq
 499998127     gbsts5.seq
 456725186     gbsts6.seq
 499999303     gbsts7.seq
 499999382     gbsts8.seq
  21009609     gbsts9.seq
 300842027     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 498979310     gbsyn22.seq
 495655717     gbsyn23.seq
 499996288     gbsyn24.seq
 435006371     gbsyn25.seq
 499993129     gbsyn26.seq
 499997802     gbsyn27.seq
 499998427     gbsyn28.seq
 249085870     gbsyn29.seq
 372527353     gbsyn3.seq
 469645438     gbsyn30.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999170     gbtsa1.seq
 499997170     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 472601874     gbtsa107.seq
 499998000     gbtsa108.seq
 499995608     gbtsa109.seq
 499999169     gbtsa11.seq
 233503542     gbtsa110.seq
 499991596     gbtsa111.seq
 499999834     gbtsa112.seq
 499999770     gbtsa113.seq
 499998939     gbtsa114.seq
  34150369     gbtsa115.seq
 499995781     gbtsa116.seq
 499999069     gbtsa117.seq
 499994937     gbtsa118.seq
 470659755     gbtsa119.seq
 280571641     gbtsa12.seq
 499998218     gbtsa120.seq
 499998672     gbtsa121.seq
 499999924     gbtsa122.seq
 280313902     gbtsa123.seq
 499999116     gbtsa124.seq
 499998111     gbtsa125.seq
 499999818     gbtsa126.seq
 423256101     gbtsa127.seq
 499996305     gbtsa13.seq
 499999062     gbtsa14.seq
 161780319     gbtsa15.seq
 500000121     gbtsa16.seq
 499994772     gbtsa17.seq
 260516544     gbtsa18.seq
 499998904     gbtsa19.seq
 499999528     gbtsa2.seq
 500000036     gbtsa20.seq
 499995141     gbtsa21.seq
  72460486     gbtsa22.seq
 500000102     gbtsa23.seq
 499998850     gbtsa24.seq
 499999664     gbtsa25.seq
 284712908     gbtsa26.seq
 499999143     gbtsa27.seq
 499999640     gbtsa28.seq
  77188803     gbtsa29.seq
 148639076     gbtsa3.seq
 499999538     gbtsa30.seq
 499998402     gbtsa31.seq
 160181305     gbtsa32.seq
 499998942     gbtsa33.seq
 499997585     gbtsa34.seq
 499998185     gbtsa35.seq
 492954858     gbtsa36.seq
 499999905     gbtsa37.seq
 499998822     gbtsa38.seq
 499996375     gbtsa39.seq
 499998486     gbtsa4.seq
 229182509     gbtsa40.seq
 499997763     gbtsa41.seq
 499999567     gbtsa42.seq
 499999364     gbtsa43.seq
 177582677     gbtsa44.seq
 499998570     gbtsa45.seq
 499998681     gbtsa46.seq
 356101733     gbtsa47.seq
 499999382     gbtsa48.seq
 499999056     gbtsa49.seq
 499998583     gbtsa5.seq
 298479435     gbtsa50.seq
 499997916     gbtsa51.seq
 499999591     gbtsa52.seq
 402924700     gbtsa53.seq
 499999696     gbtsa54.seq
 499997992     gbtsa55.seq
 499998333     gbtsa56.seq
 343934196     gbtsa57.seq
 499999894     gbtsa58.seq
 499999312     gbtsa59.seq
  58524370     gbtsa6.seq
 499996663     gbtsa60.seq
 226876032     gbtsa61.seq
 499998883     gbtsa62.seq
 499998945     gbtsa63.seq
 261554469     gbtsa64.seq
 499999567     gbtsa65.seq
 464262990     gbtsa66.seq
 499998462     gbtsa67.seq
 499999620     gbtsa68.seq
 499998268     gbtsa69.seq
 499998361     gbtsa7.seq
 168770314     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499998125     gbtsa75.seq
 499999999     gbtsa76.seq
 131338866     gbtsa77.seq
 500000012     gbtsa78.seq
 499999875     gbtsa79.seq
 499999426     gbtsa8.seq
  34997856     gbtsa80.seq
 499999375     gbtsa81.seq
 499997355     gbtsa82.seq
 499996990     gbtsa83.seq
 499997400     gbtsa84.seq
  48843479     gbtsa85.seq
 499997725     gbtsa86.seq
 499999047     gbtsa87.seq
 499998830     gbtsa88.seq
  83128617     gbtsa89.seq
 274552792     gbtsa9.seq
 499998662     gbtsa90.seq
 390370134     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499999734     gbtsa96.seq
 499998253     gbtsa97.seq
 499996332     gbtsa98.seq
 230879944     gbtsa99.seq
   7316851     gbuna1.seq
 499998709     gbvrl1.seq
 315101551     gbvrl10.seq
 499960060     gbvrl100.seq
 499973423     gbvrl1000.se
 433047615     gbvrl1001.se
 499991710     gbvrl1002.se
 499994036     gbvrl1003.se
 499989401     gbvrl1004.se
 499984663     gbvrl1005.se
  83227543     gbvrl1006.se
 499972477     gbvrl1007.se
 499968473     gbvrl1008.se
 499987568     gbvrl1009.se
 499993674     gbvrl101.seq
 499964281     gbvrl1010.se
 101935477     gbvrl1011.se
 499959573     gbvrl1012.se
 499976239     gbvrl1013.se
 499984409     gbvrl1014.se
 369334715     gbvrl1015.se
 499979245     gbvrl1016.se
 499979721     gbvrl1017.se
 499979821     gbvrl1018.se
 499963429     gbvrl1019.se
 202481508     gbvrl102.seq
 160099447     gbvrl1020.se
 499972227     gbvrl1021.se
 499975329     gbvrl1022.se
 499983189     gbvrl1023.se
 499983490     gbvrl1024.se
 499992002     gbvrl1025.se
 103867249     gbvrl1026.se
 499985908     gbvrl1027.se
 499963642     gbvrl1028.se
 499983539     gbvrl1029.se
 499945861     gbvrl103.seq
 500000000     gbvrl1030.se
 307395367     gbvrl1031.se
 499961016     gbvrl1032.se
 499968835     gbvrl1033.se
 499992120     gbvrl1034.se
 324381302     gbvrl1035.se
 499982522     gbvrl1036.se
 499972967     gbvrl1037.se
 499972756     gbvrl1038.se
 499961382     gbvrl1039.se
 499993489     gbvrl104.seq
 499987423     gbvrl1040.se
 178045189     gbvrl1041.se
 499992266     gbvrl1042.se
 499999515     gbvrl1043.se
 499999971     gbvrl1044.se
 185947857     gbvrl1045.se
 499960835     gbvrl1046.se
 499976145     gbvrl1047.se
 499962382     gbvrl1048.se
 499988045     gbvrl1049.se
 499969143     gbvrl105.seq
 435791362     gbvrl1050.se
 499979538     gbvrl1051.se
 499988396     gbvrl1052.se
 499995815     gbvrl1053.se
 499974470     gbvrl1054.se
 267421335     gbvrl1055.se
 499970207     gbvrl1056.se
 499979885     gbvrl1057.se
 499976341     gbvrl1058.se
 499986328     gbvrl1059.se
 252147323     gbvrl106.seq
 499967623     gbvrl1060.se
  99741919     gbvrl1061.se
 499969024     gbvrl1062.se
 499960580     gbvrl1063.se
 499965049     gbvrl1064.se
 168973421     gbvrl1065.se
 499983495     gbvrl1066.se
 499987107     gbvrl1067.se
 499993791     gbvrl1068.se
 499985099     gbvrl1069.se
 499939986     gbvrl107.seq
 499981273     gbvrl1070.se
 323937529     gbvrl1071.se
 499994108     gbvrl1072.se
 499982446     gbvrl1073.se
 499989804     gbvrl1074.se
 351389973     gbvrl1075.se
 499972426     gbvrl1076.se
 499940245     gbvrl1077.se
 499950871     gbvrl1078.se
 267177707     gbvrl1079.se
 499943109     gbvrl108.seq
 499953146     gbvrl1080.se
 499963515     gbvrl1081.se
 499941705     gbvrl1082.se
 138224635     gbvrl1083.se
 499950125     gbvrl1084.se
 499948105     gbvrl1085.se
 499948669     gbvrl1086.se
 147461231     gbvrl1087.se
 499934073     gbvrl1088.se
 499948866     gbvrl1089.se
 499950409     gbvrl109.seq
 499989129     gbvrl1090.se
 151036225     gbvrl1091.se
 499983400     gbvrl1092.se
 499957290     gbvrl1093.se
 499938584     gbvrl1094.se
 370878098     gbvrl1095.se
 500000240     gbvrl11.seq
 447575200     gbvrl110.seq
 499974451     gbvrl111.seq
 499948725     gbvrl112.seq
 499934036     gbvrl113.seq
 147258184     gbvrl114.seq
 499945893     gbvrl115.seq
 499975442     gbvrl116.seq
 499996356     gbvrl117.seq
 499992767     gbvrl118.seq
  11677548     gbvrl119.seq
 499997810     gbvrl12.seq
 499983254     gbvrl120.seq
 499996166     gbvrl121.seq
 499944146     gbvrl122.seq
 261077215     gbvrl123.seq
 499988967     gbvrl124.seq
 499940262     gbvrl125.seq
 499965475     gbvrl126.seq
 499938069     gbvrl127.seq
  10734996     gbvrl128.seq
 499948680     gbvrl129.seq
 499999454     gbvrl13.seq
 499992082     gbvrl130.seq
 499997878     gbvrl131.seq
 499991585     gbvrl132.seq
 317292776     gbvrl133.seq
 499983054     gbvrl134.seq
 500000248     gbvrl135.seq
 499973059     gbvrl136.seq
 499982774     gbvrl137.seq
 499974584     gbvrl138.seq
 230219843     gbvrl139.seq
 167716575     gbvrl14.seq
 499996809     gbvrl140.seq
 499999895     gbvrl141.seq
 499991400     gbvrl142.seq
 325521675     gbvrl143.seq
 499966066     gbvrl144.seq
 499968818     gbvrl145.seq
 499980029     gbvrl146.seq
 301217569     gbvrl147.seq
 499979028     gbvrl148.seq
 499960001     gbvrl149.seq
 499997304     gbvrl15.seq
 499980815     gbvrl150.seq
 188041568     gbvrl151.seq
 499940481     gbvrl152.seq
 499966248     gbvrl153.seq
 499992697     gbvrl154.seq
 499935005     gbvrl155.seq
 263691398     gbvrl156.seq
 499994928     gbvrl157.seq
 499954320     gbvrl158.seq
 499996427     gbvrl159.seq
 499999037     gbvrl16.seq
 240076943     gbvrl160.seq
 499961866     gbvrl161.seq
 499981491     gbvrl162.seq
 499963979     gbvrl163.seq
 499938599     gbvrl164.seq
 268425091     gbvrl165.seq
 499935212     gbvrl166.seq
 499955895     gbvrl167.seq
 499960906     gbvrl168.seq
 499979556     gbvrl169.seq
 137049682     gbvrl17.seq
 230286107     gbvrl170.seq
 499994101     gbvrl171.seq
 499988195     gbvrl172.seq
 499987737     gbvrl173.seq
 338461002     gbvrl174.seq
 499944059     gbvrl175.seq
 499975871     gbvrl176.seq
 499950142     gbvrl177.seq
 135729438     gbvrl178.seq
 499984458     gbvrl179.seq
 499997218     gbvrl18.seq
 499934404     gbvrl180.seq
 499997472     gbvrl181.seq
 154420332     gbvrl182.seq
 499977523     gbvrl183.seq
 499960236     gbvrl184.seq
 499971922     gbvrl185.seq
 493177685     gbvrl186.seq
 499959914     gbvrl187.seq
 499935842     gbvrl188.seq
 499993010     gbvrl189.seq
 499999346     gbvrl19.seq
 499982922     gbvrl190.seq
   7432721     gbvrl191.seq
 499951054     gbvrl192.seq
 499946701     gbvrl193.seq
 499989336     gbvrl194.seq
 177144588     gbvrl195.seq
 499974446     gbvrl196.seq
 499955314     gbvrl197.seq
 499941593     gbvrl198.seq
 499989411     gbvrl199.seq
 499994531     gbvrl2.seq
 321494786     gbvrl20.seq
 268313859     gbvrl200.seq
 499962119     gbvrl201.seq
 500000195     gbvrl202.seq
 499967693     gbvrl203.seq
 499985526     gbvrl204.seq
 282768194     gbvrl205.seq
 499936813     gbvrl206.seq
 499959861     gbvrl207.seq
 499981132     gbvrl208.seq
 499934353     gbvrl209.seq
 499993685     gbvrl21.seq
 313535749     gbvrl210.seq
 499990914     gbvrl211.seq
 499969757     gbvrl212.seq
 499981840     gbvrl213.seq
 499978639     gbvrl214.seq
 286863642     gbvrl215.seq
 499970217     gbvrl216.seq
 499982382     gbvrl217.seq
 499934014     gbvrl218.seq
 499979769     gbvrl219.seq
 499997946     gbvrl22.seq
 270981379     gbvrl220.seq
 499968524     gbvrl221.seq
 499963328     gbvrl222.seq
 499947249     gbvrl223.seq
 499949383     gbvrl224.seq
 284480367     gbvrl225.seq
 499976696     gbvrl226.seq
 499995974     gbvrl227.seq
 499988986     gbvrl228.seq
 499983848     gbvrl229.seq
 348860042     gbvrl23.seq
 284053962     gbvrl230.seq
 499974800     gbvrl231.seq
 499934452     gbvrl232.seq
 499986826     gbvrl233.seq
 499962069     gbvrl234.seq
 274829487     gbvrl235.seq
 499957628     gbvrl236.seq
 499980000     gbvrl237.seq
 499942312     gbvrl238.seq
 499948683     gbvrl239.seq
 499542547     gbvrl24.seq
 239583375     gbvrl240.seq
 499995448     gbvrl241.seq
 499989671     gbvrl242.seq
 499940863     gbvrl243.seq
 499988564     gbvrl244.seq
 263144370     gbvrl245.seq
 499995908     gbvrl246.seq
 499955463     gbvrl247.seq
 499954338     gbvrl248.seq
 499991527     gbvrl249.seq
 499999556     gbvrl25.seq
 264351405     gbvrl250.seq
 499955591     gbvrl251.seq
 499944449     gbvrl252.seq
 499933908     gbvrl253.seq
 499951872     gbvrl254.seq
 264054649     gbvrl255.seq
 499948469     gbvrl256.seq
 499987219     gbvrl257.seq
 499937055     gbvrl258.seq
 137571832     gbvrl259.seq
 373390942     gbvrl26.seq
 499939737     gbvrl260.seq
 499989905     gbvrl261.seq
 499966479     gbvrl262.seq
 146244699     gbvrl263.seq
 499944789     gbvrl264.seq
 499944834     gbvrl265.seq
 499943615     gbvrl266.seq
 499968688     gbvrl267.seq
 499995153     gbvrl268.seq
 499956558     gbvrl269.seq
 499998781     gbvrl27.seq
 245792518     gbvrl270.seq
 499953049     gbvrl271.seq
 499984245     gbvrl272.seq
 499975210     gbvrl273.seq
 499964471     gbvrl274.seq
 254737531     gbvrl275.seq
 499960063     gbvrl276.seq
 499989044     gbvrl277.seq
 499958758     gbvrl278.seq
 499985868     gbvrl279.seq
 499994073     gbvrl28.seq
 262950858     gbvrl280.seq
 499933463     gbvrl281.seq
 499990210     gbvrl282.seq
 499937855     gbvrl283.seq
 499975099     gbvrl284.seq
 421440261     gbvrl285.seq
 499966811     gbvrl286.seq
 499951871     gbvrl287.seq
 499978481     gbvrl288.seq
 166973409     gbvrl289.seq
 317230695     gbvrl29.seq
 499998709     gbvrl290.seq
 499963901     gbvrl291.seq
 499995678     gbvrl292.seq
 228199220     gbvrl293.seq
 499958490     gbvrl294.seq
 499945382     gbvrl295.seq
 499971991     gbvrl296.seq
 309527775     gbvrl297.seq
 499992351     gbvrl298.seq
 499955523     gbvrl299.seq
 499950855     gbvrl3.seq
 499998521     gbvrl30.seq
 499996214     gbvrl300.seq
 269200727     gbvrl301.seq
 499977417     gbvrl302.seq
 499997321     gbvrl303.seq
 499937572     gbvrl304.seq
 372922730     gbvrl305.seq
 499987362     gbvrl306.seq
 499982413     gbvrl307.seq
 499995917     gbvrl308.seq
 386286627     gbvrl309.seq
 499995753     gbvrl31.seq
 499936519     gbvrl310.seq
 499959053     gbvrl311.seq
 499953918     gbvrl312.seq
 499996492     gbvrl313.seq
  25372997     gbvrl314.seq
 499981164     gbvrl315.seq
 499955514     gbvrl316.seq
 499946943     gbvrl317.seq
 270338506     gbvrl318.seq
 499985846     gbvrl319.seq
 499999392     gbvrl32.seq
 499944255     gbvrl320.seq
 499972554     gbvrl321.seq
 248926802     gbvrl322.seq
 499946216     gbvrl323.seq
 499958815     gbvrl324.seq
 499994043     gbvrl325.seq
 165278419     gbvrl326.seq
 500000212     gbvrl327.seq
 499984560     gbvrl328.seq
 499998230     gbvrl329.seq
 393252273     gbvrl33.seq
 499985409     gbvrl330.seq
  70613227     gbvrl331.seq
 499985499     gbvrl332.seq
 499982271     gbvrl333.seq
 499993251     gbvrl334.seq
 464591304     gbvrl335.seq
 499976156     gbvrl336.seq
 499990464     gbvrl337.seq
 499987091     gbvrl338.seq
 499948902     gbvrl339.seq
 499999796     gbvrl34.seq
   2258854     gbvrl340.seq
 499979084     gbvrl341.seq
 499962681     gbvrl342.seq
 499940572     gbvrl343.seq
 499981323     gbvrl344.seq
 147998614     gbvrl345.seq
 499943070     gbvrl346.seq
 499944766     gbvrl347.seq
 499942420     gbvrl348.seq
 191148406     gbvrl349.seq
 499970215     gbvrl35.seq
 499952125     gbvrl350.seq
 499935590     gbvrl351.seq
 499983793     gbvrl352.seq
 452050881     gbvrl353.seq
 499991371     gbvrl354.seq
 499955764     gbvrl355.seq
 499971769     gbvrl356.seq
 223023780     gbvrl357.seq
 499949824     gbvrl358.seq
 499971871     gbvrl359.seq
 435537627     gbvrl36.seq
 499949989     gbvrl360.seq
 361414694     gbvrl361.seq
 499990916     gbvrl362.seq
 499995464     gbvrl363.seq
 499971597     gbvrl364.seq
 499976672     gbvrl365.seq
 155220943     gbvrl366.seq
 499952542     gbvrl367.seq
 499955497     gbvrl368.seq
 499999095     gbvrl369.seq
 499999439     gbvrl37.seq
 495870890     gbvrl370.seq
 499942082     gbvrl371.seq
 499940276     gbvrl372.seq
 499957958     gbvrl373.seq
 498014116     gbvrl374.seq
 499939715     gbvrl375.seq
 499966453     gbvrl376.seq
 499972030     gbvrl377.seq
 278819141     gbvrl378.seq
 499970229     gbvrl379.seq
 499994039     gbvrl38.seq
 499933929     gbvrl380.seq
 499937932     gbvrl381.seq
 261317507     gbvrl382.seq
 499978082     gbvrl383.seq
 499989797     gbvrl384.seq
 499958618     gbvrl385.seq
 239623278     gbvrl386.seq
 499955437     gbvrl387.seq
 499932923     gbvrl388.seq
 499952426     gbvrl389.seq
 434128562     gbvrl39.seq
 300033077     gbvrl390.seq
 499939610     gbvrl391.seq
 499990831     gbvrl392.seq
 499954389     gbvrl393.seq
 223525698     gbvrl394.seq
 499982849     gbvrl395.seq
 499964734     gbvrl396.seq
 499994484     gbvrl397.seq
 164134330     gbvrl398.seq
 499974380     gbvrl399.seq
 499994737     gbvrl4.seq
 499999975     gbvrl40.seq
 499967172     gbvrl400.seq
 499983764     gbvrl401.seq
 233279768     gbvrl402.seq
 499998133     gbvrl403.seq
 499969645     gbvrl404.seq
 499981161     gbvrl405.seq
 459639371     gbvrl406.seq
 499981973     gbvrl407.seq
 499988975     gbvrl408.seq
 499952154     gbvrl409.seq
 499999652     gbvrl41.seq
 417449228     gbvrl410.seq
 499952366     gbvrl411.seq
 499947781     gbvrl412.seq
 499976782     gbvrl413.seq
 189778502     gbvrl414.seq
 499938260     gbvrl415.seq
 499958380     gbvrl416.seq
 499962146     gbvrl417.seq
 243596282     gbvrl418.seq
 499964907     gbvrl419.seq
 499998541     gbvrl42.seq
 499964037     gbvrl420.seq
 499961633     gbvrl421.seq
 210812954     gbvrl422.seq
 499935634     gbvrl423.seq
 499994653     gbvrl424.seq
 499951257     gbvrl425.seq
 405670791     gbvrl426.seq
 499940071     gbvrl427.seq
 499953362     gbvrl428.seq
 499989873     gbvrl429.seq
 333172249     gbvrl43.seq
 298659363     gbvrl430.seq
 499978636     gbvrl431.seq
 499937999     gbvrl432.seq
 499954499     gbvrl433.seq
 381587577     gbvrl434.seq
 499948773     gbvrl435.seq
 499974560     gbvrl436.seq
 499987664     gbvrl437.seq
 499936188     gbvrl438.seq
 122532330     gbvrl439.seq
 499961651     gbvrl44.seq
 499959870     gbvrl440.seq
 499972252     gbvrl441.seq
 499950224     gbvrl442.seq
 215469384     gbvrl443.seq
 499962495     gbvrl444.seq
 499990220     gbvrl445.seq
 499972879     gbvrl446.seq
 499997229     gbvrl447.seq
 499961172     gbvrl448.seq
 404986875     gbvrl449.seq
 499936850     gbvrl45.seq
 499999517     gbvrl450.seq
 499982001     gbvrl451.seq
 499969047     gbvrl452.seq
 283619401     gbvrl453.seq
 499996811     gbvrl454.seq
 499933775     gbvrl455.seq
 499968967     gbvrl456.seq
 167625455     gbvrl457.seq
 499991514     gbvrl458.seq
 499992775     gbvrl459.seq
 499997400     gbvrl46.seq
 499999682     gbvrl460.seq
 383391915     gbvrl461.seq
 499966375     gbvrl462.seq
 499970705     gbvrl463.seq
 499955338     gbvrl464.seq
 499938017     gbvrl465.seq
 277265009     gbvrl466.seq
 499944560     gbvrl467.seq
 499944209     gbvrl468.seq
 499968905     gbvrl469.seq
 301450954     gbvrl47.seq
 278052258     gbvrl470.seq
 499986263     gbvrl471.seq
 499939347     gbvrl472.seq
 499981503     gbvrl473.seq
 342380719     gbvrl474.seq
 499940624     gbvrl475.seq
 499998377     gbvrl476.seq
 499993004     gbvrl477.seq
 279331205     gbvrl478.seq
 499956561     gbvrl479.seq
 499954241     gbvrl48.seq
 499968177     gbvrl480.seq
 499963215     gbvrl481.seq
 288859301     gbvrl482.seq
 499976210     gbvrl483.seq
 499979350     gbvrl484.seq
 499934314     gbvrl485.seq
 456853619     gbvrl486.seq
 499940801     gbvrl487.seq
 499988101     gbvrl488.seq
 499978269     gbvrl489.seq
 499964951     gbvrl49.seq
 467706496     gbvrl490.seq
 499939547     gbvrl491.seq
 499965483     gbvrl492.seq
 499943235     gbvrl493.seq
 499973615     gbvrl494.seq
 499957431     gbvrl495.seq
 499960289     gbvrl496.seq
 237908298     gbvrl497.seq
 499984330     gbvrl498.seq
 499975511     gbvrl499.seq
  29746641     gbvrl5.seq
 499995191     gbvrl50.seq
 499990329     gbvrl500.seq
 499977720     gbvrl501.seq
 265470593     gbvrl502.seq
 499985431     gbvrl503.seq
 499948308     gbvrl504.seq
 499952291     gbvrl505.seq
 276224301     gbvrl506.seq
 499990299     gbvrl507.seq
 499970079     gbvrl508.seq
 499958122     gbvrl509.seq
 358230706     gbvrl51.seq
 191675526     gbvrl510.seq
 499998053     gbvrl511.seq
 499975456     gbvrl512.seq
 499969677     gbvrl513.seq
 223680995     gbvrl514.seq
 499994831     gbvrl515.seq
 499990971     gbvrl516.seq
 499952965     gbvrl517.seq
 236510773     gbvrl518.seq
 499997342     gbvrl519.seq
 499932352     gbvrl52.seq
 499992676     gbvrl520.seq
 499960476     gbvrl521.seq
 499940733     gbvrl522.seq
 335774034     gbvrl523.seq
 499983561     gbvrl524.seq
 499970651     gbvrl525.seq
 499995466     gbvrl526.seq
 499993247     gbvrl527.seq
 337438355     gbvrl528.seq
 499985815     gbvrl529.seq
 499983780     gbvrl53.seq
 499953105     gbvrl530.seq
 499990320     gbvrl531.seq
 499954778     gbvrl532.seq
 430539109     gbvrl533.seq
 499998722     gbvrl534.seq
 499948737     gbvrl535.seq
 499990702     gbvrl536.seq
 313562965     gbvrl537.seq
 499938269     gbvrl538.seq
 499721036     gbvrl539.seq
 499943600     gbvrl54.seq
 499982520     gbvrl540.seq
 352222044     gbvrl541.seq
 499995454     gbvrl542.seq
 499985917     gbvrl543.seq
 499956693     gbvrl544.seq
 499944267     gbvrl545.seq
 182146090     gbvrl546.seq
 499955729     gbvrl547.seq
 499963180     gbvrl548.seq
 499962896     gbvrl549.seq
 286857001     gbvrl55.seq
 230213600     gbvrl550.seq
 499933944     gbvrl551.seq
 499944546     gbvrl552.seq
 499957784     gbvrl553.seq
 310820035     gbvrl554.seq
 499943510     gbvrl555.seq
 499940746     gbvrl556.seq
 499955231     gbvrl557.seq
 222164817     gbvrl558.seq
 499973452     gbvrl559.seq
 499975594     gbvrl56.seq
 499992215     gbvrl560.seq
 499943014     gbvrl561.seq
 208236533     gbvrl562.seq
 499952641     gbvrl563.seq
 499961096     gbvrl564.seq
 499967663     gbvrl565.seq
 169962842     gbvrl566.seq
 499965997     gbvrl567.seq
 499989281     gbvrl568.seq
 499952517     gbvrl569.seq
 499971983     gbvrl57.seq
 205382902     gbvrl570.seq
 499938615     gbvrl571.seq
 499981459     gbvrl572.seq
 499847703     gbvrl573.seq
 295900745     gbvrl574.seq
 499951593     gbvrl575.seq
 499767292     gbvrl576.seq
 499989893     gbvrl577.seq
 383761833     gbvrl578.seq
 499978313     gbvrl579.seq
 499997564     gbvrl58.seq
 499956035     gbvrl580.seq
 499975509     gbvrl581.seq
 200589528     gbvrl582.seq
 499970512     gbvrl583.seq
 499998251     gbvrl584.seq
 499963675     gbvrl585.seq
 410802803     gbvrl586.seq
 499958557     gbvrl587.seq
 499963814     gbvrl588.seq
 499959083     gbvrl589.seq
 499980187     gbvrl59.seq
 499976548     gbvrl590.seq
  18237001     gbvrl591.seq
 499949937     gbvrl592.seq
 499995778     gbvrl593.seq
 499994397     gbvrl594.seq
 177744339     gbvrl595.seq
 499996441     gbvrl596.seq
 499962523     gbvrl597.seq
 499997156     gbvrl598.seq
 415265294     gbvrl599.seq
 499998593     gbvrl6.seq
 197971901     gbvrl60.seq
 499964999     gbvrl600.seq
 499975298     gbvrl601.seq
 499967689     gbvrl602.seq
 487505195     gbvrl603.seq
 499940114     gbvrl604.seq
 499959019     gbvrl605.seq
 499989590     gbvrl606.seq
 499968409     gbvrl607.seq
  97055455     gbvrl608.seq
 499992464     gbvrl609.seq
 499962764     gbvrl61.seq
 499935695     gbvrl610.seq
 499938694     gbvrl611.seq
 142720242     gbvrl612.seq
 499935370     gbvrl613.seq
 499990083     gbvrl614.seq
 499932723     gbvrl615.seq
 206401101     gbvrl616.seq
 499954425     gbvrl617.seq
 499949299     gbvrl618.seq
 499979455     gbvrl619.seq
 499998190     gbvrl62.seq
 192985326     gbvrl620.seq
 499998347     gbvrl621.seq
 499934746     gbvrl622.seq
 499988996     gbvrl623.seq
 156730832     gbvrl624.seq
 499976555     gbvrl625.seq
 499936098     gbvrl626.seq
 499980528     gbvrl627.seq
 187211567     gbvrl628.seq
 499947021     gbvrl629.seq
 499958865     gbvrl63.seq
 499965816     gbvrl630.seq
 499968619     gbvrl631.seq
 499962582     gbvrl632.seq
 149029027     gbvrl633.seq
 492738925     gbvrl634.seq
 499973021     gbvrl635.seq
 253869488     gbvrl636.seq
  76815845     gbvrl637.seq
 499979979     gbvrl638.seq
 499965262     gbvrl639.seq
 499969699     gbvrl64.seq
 499992805     gbvrl640.seq
 252210177     gbvrl641.seq
 499979104     gbvrl642.seq
 499999809     gbvrl643.seq
 499964201     gbvrl644.seq
 280382976     gbvrl645.seq
 499973547     gbvrl646.seq
 499964780     gbvrl647.seq
 499974018     gbvrl648.seq
 175135386     gbvrl649.seq
 186644611     gbvrl65.seq
 499973309     gbvrl650.seq
 499989608     gbvrl651.seq
 499960757     gbvrl652.seq
 147804991     gbvrl653.seq
 499996522     gbvrl654.seq
 499971122     gbvrl655.seq
 499973686     gbvrl656.seq
 259661349     gbvrl657.seq
 499963274     gbvrl658.seq
 499968852     gbvrl659.seq
 499959229     gbvrl66.seq
 499994020     gbvrl660.seq
 141758832     gbvrl661.seq
 499987428     gbvrl662.seq
 499986183     gbvrl663.seq
 499970029     gbvrl664.seq
 119837707     gbvrl665.seq
 146296175     gbvrl666.seq
 499967013     gbvrl667.seq
 499996633     gbvrl668.seq
 499970769     gbvrl669.seq
 499989237     gbvrl67.seq
 126388437     gbvrl670.seq
 499995120     gbvrl671.seq
 499972873     gbvrl672.seq
 499969488     gbvrl673.seq
 471353671     gbvrl674.seq
 499967731     gbvrl675.seq
 499981503     gbvrl676.seq
 499966252     gbvrl677.seq
 148206664     gbvrl678.seq
 499995662     gbvrl679.seq
 499993800     gbvrl68.seq
 499985048     gbvrl680.seq
 499985400     gbvrl681.seq
 363308908     gbvrl682.seq
 499975349     gbvrl683.seq
 499995044     gbvrl684.seq
 499982421     gbvrl685.seq
 499984336     gbvrl686.seq
 281596540     gbvrl687.seq
 499978306     gbvrl688.seq
 499974491     gbvrl689.seq
 499995138     gbvrl69.seq
 499971452     gbvrl690.seq
 499960503     gbvrl691.seq
  56386242     gbvrl692.seq
 499993829     gbvrl693.seq
 499998290     gbvrl694.seq
 499998944     gbvrl695.seq
 404134109     gbvrl696.seq
 499976158     gbvrl697.seq
 499992691     gbvrl698.seq
 499970768     gbvrl699.seq
 499999106     gbvrl7.seq
 154635809     gbvrl70.seq
 358552958     gbvrl700.seq
 499994976     gbvrl701.seq
 499995631     gbvrl702.seq
 499993106     gbvrl703.seq
 247357210     gbvrl704.seq
 499986293     gbvrl705.seq
 499984816     gbvrl706.seq
 499967239     gbvrl707.seq
 314635508     gbvrl708.seq
 499961396     gbvrl709.seq
 499950078     gbvrl71.seq
 499984158     gbvrl710.seq
 499986788     gbvrl711.seq
 288025255     gbvrl712.seq
 499970230     gbvrl713.seq
 499981579     gbvrl714.seq
 499998615     gbvrl715.seq
 285158648     gbvrl716.seq
 499967026     gbvrl717.seq
 499980568     gbvrl718.seq
 499961738     gbvrl719.seq
 499970728     gbvrl72.seq
 291559508     gbvrl720.seq
 499973581     gbvrl721.seq
 499977906     gbvrl722.seq
 499972170     gbvrl723.seq
 289138070     gbvrl724.seq
 499966396     gbvrl725.seq
 499987226     gbvrl726.seq
 499974314     gbvrl727.seq
 280112559     gbvrl728.seq
 499989154     gbvrl729.seq
 499936161     gbvrl73.seq
 499975570     gbvrl730.seq
 499962760     gbvrl731.seq
 499988688     gbvrl732.seq
 137977402     gbvrl733.seq
 499991812     gbvrl734.seq
 499998884     gbvrl735.seq
 499998440     gbvrl736.seq
 499965827     gbvrl737.seq
  78679008     gbvrl738.seq
 499970339     gbvrl739.seq
 411246285     gbvrl74.seq
 499996499     gbvrl740.seq
 499984600     gbvrl741.seq
 499965087     gbvrl742.seq
  98844236     gbvrl743.seq
 499992259     gbvrl744.seq
 499990217     gbvrl745.seq
 499966023     gbvrl746.seq
 118505686     gbvrl747.seq
 499988359     gbvrl748.seq
 499970326     gbvrl749.seq
 499940609     gbvrl75.seq
 499999323     gbvrl750.seq
 128891738     gbvrl751.seq
 499961344     gbvrl752.seq
 499965246     gbvrl753.seq
 499963743     gbvrl754.seq
 129520828     gbvrl755.seq
 499989649     gbvrl756.seq
 499990091     gbvrl757.seq
 499993045     gbvrl758.seq
 499997622     gbvrl759.seq
 499986038     gbvrl76.seq
 154992715     gbvrl760.seq
 499990389     gbvrl761.seq
 499997500     gbvrl762.seq
 499978686     gbvrl763.seq
 259989341     gbvrl764.seq
 499978661     gbvrl765.seq
 499961935     gbvrl766.seq
 499976715     gbvrl767.seq
 499974967     gbvrl768.seq
 315477211     gbvrl769.seq
 499990092     gbvrl77.seq
 499978445     gbvrl770.seq
 499985683     gbvrl771.seq
 499975835     gbvrl772.seq
 400008726     gbvrl773.seq
 499960836     gbvrl774.seq
 499971777     gbvrl775.seq
 499983297     gbvrl776.seq
 499998600     gbvrl777.seq
 499963451     gbvrl778.seq
 499965104     gbvrl779.seq
 362638423     gbvrl78.seq
 128009138     gbvrl780.seq
 499998201     gbvrl781.seq
 499994429     gbvrl782.seq
 499974041     gbvrl783.seq
 499966031     gbvrl784.seq
 499992532     gbvrl785.seq
 478191694     gbvrl786.seq
 499977958     gbvrl787.seq
 499968023     gbvrl788.seq
 500000199     gbvrl789.seq
 499999421     gbvrl79.seq
 499961570     gbvrl790.seq
 392138866     gbvrl791.seq
 499987579     gbvrl792.seq
 499987807     gbvrl793.seq
 499979629     gbvrl794.seq
 499962956     gbvrl795.seq
  81093847     gbvrl796.seq
 499970748     gbvrl797.seq
 499963974     gbvrl798.seq
 499989137     gbvrl799.seq
 499998810     gbvrl8.seq
 499947431     gbvrl80.seq
 499992926     gbvrl800.seq
 499966380     gbvrl801.seq
 326924656     gbvrl802.seq
 499967744     gbvrl803.seq
 499988602     gbvrl804.seq
 499970539     gbvrl805.seq
 499992754     gbvrl806.seq
 368120436     gbvrl807.seq
 499961814     gbvrl808.seq
 499975293     gbvrl809.seq
 499984160     gbvrl81.seq
 499964890     gbvrl810.seq
 499986361     gbvrl811.seq
  24043791     gbvrl812.seq
 499969458     gbvrl813.seq
 499992114     gbvrl814.seq
 499979236     gbvrl815.seq
 499988026     gbvrl816.seq
  22590184     gbvrl817.seq
 499988892     gbvrl818.seq
 499958582     gbvrl819.seq
 326609834     gbvrl82.seq
 499998891     gbvrl820.seq
 499984766     gbvrl821.seq
  46828118     gbvrl822.seq
 499995703     gbvrl823.seq
 499968334     gbvrl824.seq
 499993852     gbvrl825.seq
 499996602     gbvrl826.seq
  10933612     gbvrl827.seq
 499984317     gbvrl828.seq
 499959785     gbvrl829.seq
 499995550     gbvrl83.seq
 499997386     gbvrl830.seq
 242993684     gbvrl831.seq
 499985905     gbvrl832.seq
 499960615     gbvrl833.seq
 499973456     gbvrl834.seq
 499990857     gbvrl835.seq
  52232764     gbvrl836.seq
 499964490     gbvrl837.seq
 499964464     gbvrl838.seq
 500000082     gbvrl839.seq
 499938641     gbvrl84.seq
 499999836     gbvrl840.seq
  59983696     gbvrl841.seq
 499995720     gbvrl842.seq
 499998218     gbvrl843.seq
 499975379     gbvrl844.seq
 191184922     gbvrl845.seq
 499990027     gbvrl846.seq
 499998072     gbvrl847.seq
 499964642     gbvrl848.seq
 187063445     gbvrl849.seq
 499973290     gbvrl85.seq
 499995967     gbvrl850.seq
 499977928     gbvrl851.seq
 499991686     gbvrl852.seq
 194078795     gbvrl853.seq
 499980969     gbvrl854.seq
 499982179     gbvrl855.seq
 499989763     gbvrl856.seq
 223834918     gbvrl857.seq
 499984500     gbvrl858.seq
 499973318     gbvrl859.seq
  45085591     gbvrl86.seq
 499970794     gbvrl860.seq
 224405807     gbvrl861.seq
 499994221     gbvrl862.seq
 499964420     gbvrl863.seq
 499989233     gbvrl864.seq
 191992835     gbvrl865.seq
 499979086     gbvrl866.seq
 499980339     gbvrl867.seq
 499975396     gbvrl868.seq
 197260979     gbvrl869.seq
 499969660     gbvrl87.seq
 499967952     gbvrl870.seq
 499999616     gbvrl871.seq
 499989909     gbvrl872.seq
 499994460     gbvrl873.seq
 499971439     gbvrl874.seq
 210537192     gbvrl875.seq
 499994396     gbvrl876.seq
 499960629     gbvrl877.seq
 499988409     gbvrl878.seq
 373194307     gbvrl879.seq
 499938360     gbvrl88.seq
 499970312     gbvrl880.seq
 499995829     gbvrl881.seq
 499993275     gbvrl882.seq
 117606948     gbvrl883.seq
 499985783     gbvrl884.seq
 499999955     gbvrl885.seq
 499997938     gbvrl886.seq
 307125894     gbvrl887.seq
 499969220     gbvrl888.seq
 499999878     gbvrl889.seq
 499982877     gbvrl89.seq
 499993728     gbvrl890.seq
 499998249     gbvrl891.seq
 499964927     gbvrl892.seq
 499968844     gbvrl893.seq
  78929220     gbvrl894.seq
 499973254     gbvrl895.seq
 499969713     gbvrl896.seq
 499969563     gbvrl897.seq
 286738372     gbvrl898.seq
 499965605     gbvrl899.seq
 500000019     gbvrl9.seq
 185102130     gbvrl90.seq
 499984803     gbvrl900.seq
 499981918     gbvrl901.seq
 499964944     gbvrl902.seq
 190811873     gbvrl903.seq
 499983057     gbvrl904.seq
 499961583     gbvrl905.seq
 499995798     gbvrl906.seq
 499984248     gbvrl907.seq
 148129947     gbvrl908.seq
 499962549     gbvrl909.seq
 499995877     gbvrl91.seq
 499994082     gbvrl910.seq
 499988751     gbvrl911.seq
 499972397     gbvrl912.seq
 499984666     gbvrl913.seq
   1810975     gbvrl914.seq
 499959094     gbvrl915.seq
 499983038     gbvrl916.seq
 499992901     gbvrl917.seq
 422170540     gbvrl918.seq
 499975132     gbvrl919.seq
 499959550     gbvrl92.seq
 499995567     gbvrl920.seq
 499995290     gbvrl921.seq
 199372111     gbvrl922.seq
 499993381     gbvrl923.seq
 499985259     gbvrl924.seq
 499997469     gbvrl925.seq
 156460575     gbvrl926.seq
 499959332     gbvrl927.seq
 499968902     gbvrl928.seq
 499993349     gbvrl929.seq
 499954432     gbvrl93.seq
 499966660     gbvrl930.seq
 400354661     gbvrl931.seq
 499959638     gbvrl932.seq
 499980583     gbvrl933.seq
 499990051     gbvrl934.seq
 499973318     gbvrl935.seq
 344871922     gbvrl936.seq
 499974503     gbvrl937.seq
 499967581     gbvrl938.seq
 500000188     gbvrl939.seq
 193598966     gbvrl94.seq
 266779067     gbvrl940.seq
 499973862     gbvrl941.seq
 499988498     gbvrl942.seq
 499971868     gbvrl943.seq
 154951226     gbvrl944.seq
 499974801     gbvrl945.seq
 499970831     gbvrl946.seq
 499961802     gbvrl947.seq
 499987483     gbvrl948.seq
 499964777     gbvrl949.seq
 499969181     gbvrl95.seq
 499980832     gbvrl950.seq
 111556145     gbvrl951.seq
 499971178     gbvrl952.seq
 499975894     gbvrl953.seq
 499993408     gbvrl954.seq
 499982950     gbvrl955.seq
 499962062     gbvrl956.seq
 499993473     gbvrl957.seq
 110227900     gbvrl958.seq
 499977953     gbvrl959.seq
 499987352     gbvrl96.seq
 499988439     gbvrl960.seq
 499990785     gbvrl961.seq
 499994288     gbvrl962.seq
 499964929     gbvrl963.seq
 499972152     gbvrl964.seq
 166666603     gbvrl965.seq
 499973060     gbvrl966.seq
 499976784     gbvrl967.seq
 499975843     gbvrl968.seq
 499994641     gbvrl969.seq
 499956176     gbvrl97.seq
 333937173     gbvrl970.seq
 499993852     gbvrl971.seq
 499995349     gbvrl972.seq
 499974111     gbvrl973.seq
 499988841     gbvrl974.seq
 318630320     gbvrl975.seq
 499993744     gbvrl976.seq
 499965435     gbvrl977.seq
 499982504     gbvrl978.seq
 499977584     gbvrl979.seq
 230194956     gbvrl98.seq
 481610372     gbvrl980.seq
 499980908     gbvrl981.seq
 499998043     gbvrl982.seq
 499975412     gbvrl983.seq
 499973714     gbvrl984.seq
  48125717     gbvrl985.seq
 499986783     gbvrl986.seq
 499964953     gbvrl987.seq
 499987753     gbvrl988.seq
 153956903     gbvrl989.seq
 499988530     gbvrl99.seq
 499968881     gbvrl990.seq
 499973548     gbvrl991.seq
 499968822     gbvrl992.seq
 339023301     gbvrl993.seq
 499987569     gbvrl994.seq
 499981580     gbvrl995.seq
 499997631     gbvrl996.seq
 274621927     gbvrl997.seq
 499968003     gbvrl998.seq
 499997675     gbvrl999.seq
 499976231     gbvrt1.seq
 290137512     gbvrt10.seq
 319264825     gbvrt100.seq
 275756310     gbvrt101.seq
 252640764     gbvrt102.seq
 251496346     gbvrt103.seq
 466369517     gbvrt104.seq
 418722221     gbvrt105.seq
 186091499     gbvrt106.seq
 404212771     gbvrt107.seq
 481131818     gbvrt108.seq
 474827268     gbvrt109.seq
  87351606     gbvrt11.seq
 480710663     gbvrt110.seq
  89576281     gbvrt111.seq
 435880707     gbvrt112.seq
 487966706     gbvrt113.seq
 497561524     gbvrt114.seq
 468911725     gbvrt115.seq
1063697373     gbvrt116.seq
1045817456     gbvrt117.seq
 754876698     gbvrt118.seq
 616753988     gbvrt119.seq
 499800119     gbvrt12.seq
 490283916     gbvrt120.seq
 470651151     gbvrt121.seq
 397152890     gbvrt122.seq
 351566814     gbvrt123.seq
 339881554     gbvrt124.seq
 404716166     gbvrt125.seq
 489465929     gbvrt126.seq
 499108511     gbvrt127.seq
 486719349     gbvrt128.seq
  58362562     gbvrt129.seq
 284674796     gbvrt13.seq
 436489699     gbvrt130.seq
 486735687     gbvrt131.seq
 492786702     gbvrt132.seq
 424170309     gbvrt133.seq
 281367593     gbvrt134.seq
 478264522     gbvrt135.seq
 485840122     gbvrt136.seq
 493662272     gbvrt137.seq
  75046811     gbvrt138.seq
 979125221     gbvrt139.seq
  15637437     gbvrt14.seq
 838606764     gbvrt140.seq
 678362247     gbvrt141.seq
 476490051     gbvrt142.seq
 461393141     gbvrt143.seq
 438814149     gbvrt144.seq
 394334276     gbvrt145.seq
 313818221     gbvrt146.seq
 288999697     gbvrt147.seq
 280186115     gbvrt148.seq
 407765043     gbvrt149.seq
  36035214     gbvrt15.seq
 421853258     gbvrt150.seq
 478932645     gbvrt151.seq
 480028007     gbvrt152.seq
 438022009     gbvrt153.seq
 174441466     gbvrt154.seq
 487902327     gbvrt155.seq
 456814552     gbvrt156.seq
 462308829     gbvrt157.seq
 168813991     gbvrt158.seq
 455915969     gbvrt159.seq
  18509260     gbvrt16.seq
 469542169     gbvrt160.seq
 479148432     gbvrt161.seq
 211438035     gbvrt162.seq
 481255007     gbvrt163.seq
 475910680     gbvrt164.seq
 366785231     gbvrt165.seq
 464881586     gbvrt166.seq
 474452025     gbvrt167.seq
 234874130     gbvrt168.seq
 697335450     gbvrt169.seq
 497676963     gbvrt17.seq
 670835803     gbvrt170.seq
 524090553     gbvrt171.seq
 413420126     gbvrt172.seq
 345317144     gbvrt173.seq
 329841089     gbvrt174.seq
 250750417     gbvrt175.seq
 486600390     gbvrt176.seq
 364885711     gbvrt177.seq
 448395879     gbvrt178.seq
 471877569     gbvrt179.seq
 497173924     gbvrt18.seq
 393642536     gbvrt180.seq
 355134416     gbvrt181.seq
 470602746     gbvrt182.seq
 448657488     gbvrt183.seq
 384724558     gbvrt184.seq
 432320923     gbvrt185.seq
 471604977     gbvrt186.seq
 497676594     gbvrt187.seq
 207882210     gbvrt188.seq
 397267013     gbvrt189.seq
 481350583     gbvrt19.seq
 366771863     gbvrt190.seq
 351249970     gbvrt191.seq
 309532358     gbvrt192.seq
 296271444     gbvrt193.seq
 286321426     gbvrt194.seq
 268164730     gbvrt195.seq
 253329800     gbvrt196.seq
 494939336     gbvrt197.seq
 424426418     gbvrt198.seq
 410896883     gbvrt199.seq
 499844039     gbvrt2.seq
 400795564     gbvrt20.seq
 369957025     gbvrt200.seq
 169574120     gbvrt201.seq
 426847158     gbvrt202.seq
 496824472     gbvrt203.seq
 434394575     gbvrt204.seq
 494362940     gbvrt205.seq
  61896390     gbvrt206.seq
 431425030     gbvrt207.seq
 474666078     gbvrt208.seq
 479195533     gbvrt209.seq
 488197715     gbvrt21.seq
 352877912     gbvrt210.seq
 479777961     gbvrt211.seq
 497464627     gbvrt212.seq
 432868094     gbvrt213.seq
 439843808     gbvrt214.seq
 469531790     gbvrt215.seq
 496015817     gbvrt216.seq
 488626307     gbvrt217.seq
 432135676     gbvrt218.seq
  70119528     gbvrt219.seq
 479291185     gbvrt22.seq
 491056051     gbvrt220.seq
 328508705     gbvrt221.seq
 497328806     gbvrt222.seq
 499238966     gbvrt223.seq
 187508760     gbvrt224.seq
 490842556     gbvrt225.seq
 463385772     gbvrt226.seq
 446788975     gbvrt227.seq
 438416202     gbvrt228.seq
 170595769     gbvrt229.seq
 480798341     gbvrt23.seq
 451342688     gbvrt230.seq
 474563355     gbvrt231.seq
 461335548     gbvrt232.seq
 436658187     gbvrt233.seq
 154682616     gbvrt234.seq
 456837606     gbvrt235.seq
 488930196     gbvrt236.seq
 466502331     gbvrt237.seq
 455725140     gbvrt238.seq
 453475816     gbvrt239.seq
 499274582     gbvrt24.seq
 462276007     gbvrt240.seq
 497473221     gbvrt241.seq
 499283767     gbvrt242.seq
 481742871     gbvrt243.seq
  54779872     gbvrt244.seq
 477445338     gbvrt245.seq
 495314530     gbvrt246.seq
 486008997     gbvrt247.seq
 489201368     gbvrt248.seq
 499536480     gbvrt249.seq
 483255310     gbvrt25.seq
 347470388     gbvrt250.seq
1068402516     gbvrt251.seq
1067356333     gbvrt252.seq
 896844819     gbvrt253.seq
 805318347     gbvrt254.seq
 718662677     gbvrt255.seq
 556944666     gbvrt256.seq
 299728838     gbvrt257.seq
 293507186     gbvrt258.seq
 484357811     gbvrt259.seq
 484154141     gbvrt26.seq
 130768604     gbvrt260.seq
 874873715     gbvrt261.seq
 685858825     gbvrt262.seq
 627564227     gbvrt263.seq
 610271897     gbvrt264.seq
 543871783     gbvrt265.seq
 284797667     gbvrt266.seq
 269299175     gbvrt267.seq
 474717664     gbvrt268.seq
 402979396     gbvrt269.seq
  65325644     gbvrt27.seq
 343325815     gbvrt270.seq
 450550965     gbvrt271.seq
 494368803     gbvrt272.seq
 470719618     gbvrt273.seq
 470514883     gbvrt274.seq
 229726934     gbvrt275.seq
 500000129     gbvrt276.seq
 499998950     gbvrt277.seq
 499998793     gbvrt278.seq
  29493255     gbvrt279.seq
 437233554     gbvrt28.seq
 499997750     gbvrt280.seq
 499998227     gbvrt281.seq
 499997740     gbvrt282.seq
 283794002     gbvrt283.seq
 445682876     gbvrt284.seq
 474231618     gbvrt285.seq
 490948606     gbvrt286.seq
 332589082     gbvrt287.seq
 477156039     gbvrt288.seq
 499226352     gbvrt289.seq
 488520688     gbvrt29.seq
 477696169     gbvrt290.seq
 353039605     gbvrt291.seq
 438196164     gbvrt292.seq
 489809255     gbvrt293.seq
 460938782     gbvrt294.seq
 425935803     gbvrt295.seq
 463058640     gbvrt296.seq
 486385420     gbvrt297.seq
 437842391     gbvrt298.seq
 440417012     gbvrt299.seq
 467954433     gbvrt3.seq
 456456384     gbvrt30.seq
 475637321     gbvrt300.seq
 477247535     gbvrt301.seq
 464765084     gbvrt302.seq
 442158629     gbvrt303.seq
 490038950     gbvrt304.seq
 437760826     gbvrt305.seq
 442760644     gbvrt306.seq
 386023782     gbvrt307.seq
 474714280     gbvrt308.seq
 485233797     gbvrt309.seq
 337132552     gbvrt31.seq
 481701496     gbvrt310.seq
 437638720     gbvrt311.seq
 484571077     gbvrt312.seq
 497401344     gbvrt313.seq
 473482376     gbvrt314.seq
 467112365     gbvrt315.seq
 171814162     gbvrt316.seq
  85205330     gbvrt317.seq
 671198197     gbvrt318.seq
 590897252     gbvrt319.seq
 446089299     gbvrt32.seq
 569239246     gbvrt320.seq
 521483379     gbvrt321.seq
 518191557     gbvrt322.seq
 413907798     gbvrt323.seq
 491950349     gbvrt324.seq
 443427082     gbvrt325.seq
 399672190     gbvrt326.seq
 288573149     gbvrt327.seq
 447682143     gbvrt328.seq
 458968414     gbvrt329.seq
 379213975     gbvrt33.seq
 489671978     gbvrt330.seq
 498333218     gbvrt331.seq
 249806054     gbvrt332.seq
 449206571     gbvrt333.seq
 492547884     gbvrt334.seq
 481880513     gbvrt335.seq
 498774154     gbvrt336.seq
 111733219     gbvrt337.seq
 436873334     gbvrt338.seq
 440148969     gbvrt339.seq
 458139031     gbvrt34.seq
 482571941     gbvrt340.seq
 484107234     gbvrt341.seq
  52095057     gbvrt342.seq
 470800028     gbvrt343.seq
 472090268     gbvrt344.seq
 484800876     gbvrt345.seq
 476579517     gbvrt346.seq
 487431970     gbvrt347.seq
 391563647     gbvrt348.seq
 455738434     gbvrt349.seq
 111157660     gbvrt35.seq
 373020280     gbvrt350.seq
 430677277     gbvrt351.seq
 493479067     gbvrt352.seq
 489511330     gbvrt353.seq
 496625891     gbvrt354.seq
 496023577     gbvrt355.seq
 483316423     gbvrt356.seq
 455697611     gbvrt357.seq
 463738379     gbvrt358.seq
 476553580     gbvrt359.seq
 402140937     gbvrt36.seq
 382729569     gbvrt360.seq
 388762659     gbvrt361.seq
 162516535     gbvrt362.seq
 364042246     gbvrt363.seq
 406118404     gbvrt364.seq
 490080005     gbvrt365.seq
 499117150     gbvrt366.seq
 496745927     gbvrt367.seq
 114457470     gbvrt368.seq
 483642213     gbvrt369.seq
 345094744     gbvrt37.seq
 486499113     gbvrt370.seq
 480199921     gbvrt371.seq
 449130925     gbvrt372.seq
 493582352     gbvrt373.seq
 455855740     gbvrt374.seq
 496938106     gbvrt375.seq
 445299021     gbvrt376.seq
 488289465     gbvrt377.seq
 456295928     gbvrt378.seq
 491344127     gbvrt379.seq
 499274310     gbvrt38.seq
 433632055     gbvrt380.seq
 461359229     gbvrt381.seq
 352990890     gbvrt382.seq
 486129256     gbvrt383.seq
 433069569     gbvrt384.seq
 468000100     gbvrt385.seq
 213511428     gbvrt386.seq
 464521429     gbvrt387.seq
 484103168     gbvrt388.seq
 470335860     gbvrt389.seq
 359197842     gbvrt39.seq
 441506917     gbvrt390.seq
 388757745     gbvrt391.seq
 491752782     gbvrt392.seq
 465458984     gbvrt393.seq
 463577414     gbvrt394.seq
 475333006     gbvrt395.seq
  32860891     gbvrt396.seq
 448180683     gbvrt397.seq
 468563387     gbvrt398.seq
 487321652     gbvrt399.seq
 179100370     gbvrt4.seq
 495493755     gbvrt40.seq
 466578054     gbvrt400.seq
 479179652     gbvrt401.seq
 463026596     gbvrt402.seq
 420071062     gbvrt403.seq
 457719226     gbvrt404.seq
 490464485     gbvrt405.seq
 443384835     gbvrt406.seq
 462824598     gbvrt407.seq
 334830757     gbvrt408.seq
 476386342     gbvrt409.seq
 478307083     gbvrt41.seq
 491788802     gbvrt410.seq
 450398569     gbvrt411.seq
 454795466     gbvrt412.seq
 469602269     gbvrt413.seq
 452609759     gbvrt414.seq
 497531511     gbvrt415.seq
 437442433     gbvrt416.seq
 342108062     gbvrt417.seq
 427821552     gbvrt418.seq
 472175035     gbvrt419.seq
 479569827     gbvrt42.seq
 474308742     gbvrt420.seq
 115706604     gbvrt421.seq
 462970947     gbvrt422.seq
 483824917     gbvrt423.seq
 480993826     gbvrt424.seq
 425541655     gbvrt425.seq
 482200158     gbvrt426.seq
 494081566     gbvrt427.seq
 405268917     gbvrt428.seq
 462160991     gbvrt429.seq
 499582791     gbvrt43.seq
  99044719     gbvrt430.seq
 495727890     gbvrt431.seq
 499457203     gbvrt432.seq
 496827401     gbvrt433.seq
 495182596     gbvrt434.seq
 157867363     gbvrt435.seq
 474797238     gbvrt436.seq
 439268361     gbvrt437.seq
 419636722     gbvrt438.seq
 471975427     gbvrt439.seq
 109962708     gbvrt44.seq
 294229625     gbvrt440.seq
 418033300     gbvrt441.seq
 453670883     gbvrt442.seq
 492403889     gbvrt443.seq
 439486134     gbvrt444.seq
 438375278     gbvrt445.seq
 477518353     gbvrt446.seq
 490480491     gbvrt447.seq
 480679107     gbvrt448.seq
 492157733     gbvrt449.seq
 493406215     gbvrt45.seq
 199437741     gbvrt450.seq
 478924327     gbvrt451.seq
 438315028     gbvrt452.seq
 439741604     gbvrt453.seq
 461529329     gbvrt454.seq
 488438312     gbvrt455.seq
 103295169     gbvrt456.seq
 483017127     gbvrt457.seq
 466200874     gbvrt458.seq
 411265058     gbvrt459.seq
 487488921     gbvrt46.seq
 486575674     gbvrt460.seq
 297876207     gbvrt461.seq
 429098988     gbvrt462.seq
 438830218     gbvrt463.seq
 481726385     gbvrt464.seq
 485911064     gbvrt465.seq
 435037055     gbvrt466.seq
 493235159     gbvrt467.seq
 482533224     gbvrt468.seq
 124789632     gbvrt469.seq
 426877541     gbvrt47.seq
 323032683     gbvrt470.seq
 369600226     gbvrt471.seq
 457093781     gbvrt472.seq
 436813210     gbvrt473.seq
 496330530     gbvrt474.seq
 495693233     gbvrt475.seq
 466752026     gbvrt476.seq
 199939234     gbvrt477.seq
 480396248     gbvrt478.seq
 461404102     gbvrt479.seq
 444428072     gbvrt48.seq
 489903935     gbvrt480.seq
 388326134     gbvrt481.seq
 442642585     gbvrt482.seq
 169256572     gbvrt483.seq
 440392633     gbvrt484.seq
 432958536     gbvrt485.seq
 462430807     gbvrt486.seq
 434208796     gbvrt487.seq
 390926788     gbvrt488.seq
 487050412     gbvrt489.seq
 464099563     gbvrt49.seq
 493172616     gbvrt490.seq
 466690640     gbvrt491.seq
 474437294     gbvrt492.seq
 295373792     gbvrt493.seq
 491418844     gbvrt494.seq
 345870589     gbvrt495.seq
 491561111     gbvrt496.seq
 464430708     gbvrt497.seq
 498570982     gbvrt498.seq
 102451714     gbvrt499.seq
 448778544     gbvrt5.seq
 157849261     gbvrt50.seq
 473497850     gbvrt500.seq
 464739015     gbvrt501.seq
 462486427     gbvrt502.seq
 348110498     gbvrt503.seq
 486739527     gbvrt504.seq
 474299013     gbvrt505.seq
 482556063     gbvrt506.seq
 472095997     gbvrt507.seq
 481509131     gbvrt508.seq
 344867026     gbvrt509.seq
  14152653     gbvrt51.seq
 319747509     gbvrt510.seq
 294452527     gbvrt511.seq
 259683468     gbvrt512.seq
 496914092     gbvrt513.seq
 445665038     gbvrt514.seq
 365237321     gbvrt515.seq
 422305844     gbvrt516.seq
 102143121     gbvrt517.seq
 462745258     gbvrt518.seq
 468352662     gbvrt519.seq
  21384662     gbvrt52.seq
 359201870     gbvrt520.seq
 277305730     gbvrt521.seq
 486477418     gbvrt522.seq
 493194515     gbvrt523.seq
 410286580     gbvrt524.seq
 487454364     gbvrt525.seq
 268180715     gbvrt526.seq
 420546242     gbvrt527.seq
 477553729     gbvrt528.seq
 481366956     gbvrt529.seq
  90973101     gbvrt53.seq
 444950980     gbvrt530.seq
 451374017     gbvrt531.seq
 103288017     gbvrt532.seq
 451569910     gbvrt533.seq
 380073467     gbvrt534.seq
 434691682     gbvrt535.seq
 471518140     gbvrt536.seq
 105009709     gbvrt537.seq
 495643890     gbvrt538.seq
 499124391     gbvrt539.seq
 499951059     gbvrt54.seq
 497403056     gbvrt540.seq
 313091218     gbvrt541.seq
 459021489     gbvrt542.seq
 151106526     gbvrt543.seq
 493221737     gbvrt544.seq
 337765201     gbvrt545.seq
 489468080     gbvrt546.seq
 392687660     gbvrt547.seq
 487635690     gbvrt548.seq
 444942159     gbvrt549.seq
 500000178     gbvrt55.seq
 465228543     gbvrt550.seq
 400800039     gbvrt551.seq
 409788724     gbvrt552.seq
 296305505     gbvrt553.seq
 271758528     gbvrt554.seq
 265258596     gbvrt555.seq
 263761059     gbvrt556.seq
 473237329     gbvrt557.seq
 391745242     gbvrt558.seq
 343553702     gbvrt559.seq
 499999472     gbvrt56.seq
 329809609     gbvrt560.seq
 433600879     gbvrt561.seq
 489628012     gbvrt562.seq
 467831137     gbvrt563.seq
 461258912     gbvrt564.seq
  44048434     gbvrt565.seq
 331764752     gbvrt566.seq
 464133617     gbvrt567.seq
 496250487     gbvrt568.seq
 492153129     gbvrt569.seq
  55973042     gbvrt57.seq
 343521723     gbvrt570.seq
 462279408     gbvrt571.seq
 469961167     gbvrt572.seq
 492694871     gbvrt573.seq
 482668248     gbvrt574.seq
 218256438     gbvrt575.seq
 499999708     gbvrt58.seq
 270397732     gbvrt59.seq
 490703641     gbvrt6.seq
 499998686     gbvrt60.seq
 121299031     gbvrt61.seq
 499999309     gbvrt62.seq
 448533882     gbvrt63.seq
 499999886     gbvrt64.seq
  29257303     gbvrt65.seq
 444411655     gbvrt66.seq
 499998281     gbvrt67.seq
 388821435     gbvrt68.seq
 499999254     gbvrt69.seq
 499120716     gbvrt7.seq
 280114924     gbvrt70.seq
 499999117     gbvrt71.seq
 499996672     gbvrt72.seq
 497071337     gbvrt73.seq
 499630950     gbvrt74.seq
 499990415     gbvrt75.seq
 462471618     gbvrt76.seq
 202128841     gbvrt77.seq
 123737443     gbvrt78.seq
 483315271     gbvrt79.seq
 483703423     gbvrt8.seq
 481925744     gbvrt80.seq
 499146212     gbvrt81.seq
 499983703     gbvrt82.seq
 297372571     gbvrt83.seq
 492211550     gbvrt84.seq
 492375887     gbvrt85.seq
 479677491     gbvrt86.seq
 480814553     gbvrt87.seq
 362168611     gbvrt88.seq
 487931186     gbvrt89.seq
 263825361     gbvrt9.seq
 465950606     gbvrt90.seq
 489430322     gbvrt91.seq
 352376679     gbvrt92.seq
 465372186     gbvrt93.seq
 488788789     gbvrt94.seq
 189348250     gbvrt95.seq
 451948482     gbvrt96.seq
 443703248     gbvrt97.seq
 400719178     gbvrt98.seq
 427517644     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         102016     184379131
BCT10        102        246510870
BCT100       90         224039666
BCT100       134        235129215
BCT100       115        228912035
BCT100       102        106601372
BCT100       115        203586737
BCT100       104        226028015
BCT100       96         218584648
BCT100       97         227951499
BCT100       83         131115977
BCT100       106        211161090
BCT100       83         206170690
BCT101       98         225070223
BCT101       64         206847127
BCT101       161        208588334
BCT101       136        216587635
BCT101       92         167067351
BCT101       95         210421811
BCT101       116        224818885
BCT101       135        212683110
BCT101       117        206659057
BCT101       100        116200289
BCT101       140        202136849
BCT102       58         138528232
BCT102       99         239136997
BCT102       114        204129524
BCT102       95         220406826
BCT102       106        215751826
BCT102       117        217573203
BCT102       106        236203897
BCT102       132        213387429
BCT102       146        202452910
BCT102       21         57485240
BCT102       91         214961341
BCT103       53         211054879
BCT103       85         213862553
BCT103       116        231089197
BCT103       163        221184134
BCT103       169        167480387
BCT103       99         230958440
BCT103       144        211143166
BCT103       95         210053513
BCT103       73         206035438
BCT103       159        210065937
BCT103       17         39453697
BCT104       45         210584326
BCT104       95         206627544
BCT104       144        207227598
BCT104       126        212122743
BCT104       113        215058720
BCT104       152        209472212
BCT104       21         45775661
BCT104       108        213619490
BCT104       122        217401288
BCT104       127        214862676
BCT104       144        207576401
BCT105       45         210864282
BCT105       110        196816946
BCT105       92         214664273
BCT105       53         215187127
BCT105       48         207074053
BCT105       66         201797601
BCT105       67         204825713
BCT105       95         207808075
BCT105       164        213028389
BCT105       132        143710142
BCT105       143        211484895
BCT106       45         212727898
BCT106       141        216775348
BCT106       93         209518297
BCT106       104        219360911
BCT106       62         105294553
BCT106       103        210615479
BCT106       132        205651899
BCT106       126        200902918
BCT106       146        257876858
BCT106       126        203135451
BCT106       11         39417326
BCT107       76         222861078
BCT107       124        209895621
BCT107       182        217456644
BCT107       120        261213212
BCT107       79         202934376
BCT107       117        211165709
BCT107       94         222051330
BCT107       112        214113604
BCT107       151        197301962
BCT107       189        199519901
BCT107       194        203527827
BCT108       40         115080869
BCT108       70         95972423
BCT108       107        202699573
BCT108       109        213768140
BCT108       131        198442998
BCT108       117        205117537
BCT108       92         207797846
BCT108       107        209655182
BCT108       16         31567328
BCT108       127        206571320
BCT108       72         210327486
BCT109       112        227959956
BCT109       45         205507706
BCT109       33         205557479
BCT109       3          21040570
BCT109       38         200622777
BCT109       57         210996969
BCT109       87         229797365
BCT109       105        212001413
BCT109       143        219033653
BCT109       179        214419595
BCT109       73         62531391
BCT11        141        236989370
BCT110       129        231316827
BCT110       528        115589384
BCT110       1589       2511957
BCT110       3172       5268484
BCT110       6338       7796395
BCT110       12613      14997690
BCT110       25523      27672494
BCT110       50566      54072396
BCT110       148854     156684290
BCT110       14230      193553348
BCT110       3297       203942569
BCT111       99         245428056
BCT111       2512       213432676
BCT111       7212       212654349
BCT111       164        249069009
BCT111       39928      39703867
BCT111       75125      183083691
BCT111       11034      200066507
BCT111       6078       200796727
BCT111       100672     182698124
BCT111       60999      67448214
BCT111       149155     156910442
BCT112       87         223381451
BCT112       84585      88136036
BCT112       144566     151063496
BCT112       25927      25602726
BCT112       132534     167488185
BCT112       31546      43761167
BCT112       116460     178490515
BCT112       7619       17055808
BCT112       33016      54145060
BCT112       41199      224779504
BCT112       5144       322651386
BCT113       59         181990919
BCT113       3043       52121002
BCT113       5034       225438591
BCT113       3847       224092509
BCT113       1442       273316652
BCT113       109        222593498
BCT113       55         216844860
BCT113       70         213822191
BCT113       34         137765382
BCT113       69         224394912
BCT113       364        238323955
BCT114       93         237302287
BCT114       889        289911825
BCT114       316        85816731
BCT114       1274       198668008
BCT114       287        209619920
BCT114       559        377168493
BCT114       919        316619406
BCT114       271        80140439
BCT114       3148       246273076
BCT114       661        247595544
BCT114       368        370985581
BCT115       103        223843089
BCT115       350        254527429
BCT115       362        393266490
BCT115       351        385253095
BCT115       330        252129872
BCT115       1935       224001909
BCT115       20         40370455
BCT115       86         222746849
BCT115       78         227354684
BCT115       3023       245927078
BCT115       1230       124242115
BCT116       62         225168570
BCT116       1412       261424764
BCT116       47         241352896
BCT116       45         243003094
BCT116       2180       269716913
BCT116       945        54278114
BCT116       2284       261463112
BCT116       87         288890299
BCT116       417        278222635
BCT116       3023       263078339
BCT116       11940      19905115
BCT117       64         140507059
BCT117       25214      42009480
BCT117       118251     188698156
BCT117       114833     191975949
BCT117       92358      166857865
BCT117       97831      200538961
BCT117       119674     193415505
BCT117       54562      295652979
BCT117       122459     202305133
BCT117       98331      227594643
BCT117       724        181153446
BCT118       89         229551845
BCT118       358        274616850
BCT118       156        207619882
BCT118       208        205768159
BCT118       197        205113543
BCT118       200        205637754
BCT118       173        202326691
BCT118       45         60784238
BCT118       179        205883676
BCT118       202        206537177
BCT118       226        205678653
BCT119       90         230404163
BCT119       173        206520918
BCT119       37         50683886
BCT119       237        205937725
BCT119       304        211429514
BCT119       248        235438689
BCT119       890        214955458
BCT119       152        271521130
BCT119       600        313227342
BCT119       587        233046879
BCT119       280        274505337
BCT12        161        262427707
BCT120       99         240958902
BCT120       53036      279823416
BCT120       3401       5215316
BCT121       27         42382325
BCT122       94         226656782
BCT123       118        229172914
BCT124       129        235728302
BCT125       60         116779005
BCT126       114        212138354
BCT127       75         223237061
BCT128       112        225347102
BCT129       124        217786851
BCT13        18         24867996
BCT130       3          5977905
BCT131       246        222256023
BCT132       104        221252195
BCT133       100        224644129
BCT134       83         222703364
BCT135       21         86233168
BCT136       68         221578114
BCT137       87         219795809
BCT138       85         224407383
BCT139       80         222158521
BCT14        169        234246001
BCT140       4          11001364
BCT141       124        217933644
BCT142       53         217706139
BCT143       90         227492926
BCT144       57         149506400
BCT145       94         223837173
BCT146       73         221711999
BCT147       122        215811464
BCT148       80         227727095
BCT149       8          8657925
BCT15        153        241428314
BCT150       159        220206896
BCT151       84         220629983
BCT152       79         216070642
BCT153       141        227102717
BCT154       107        224394264
BCT155       80         221199213
BCT156       92         196245950
BCT157       115        225967887
BCT158       92         220409897
BCT159       158        214217907
BCT16        187        250598365
BCT160       88         207032597
BCT161       140        220978157
BCT162       63         217844098
BCT163       90         215013764
BCT164       125        217101319
BCT165       88         223616604
BCT166       21         65066945
BCT167       174        220602866
BCT168       128        221993348
BCT169       118        216449560
BCT17        219        231641963
BCT170       170        220678969
BCT171       54         177570665
BCT172       104        218683705
BCT173       113        217389079
BCT174       151        218678288
BCT175       108        219330740
BCT176       112        226939239
BCT177       130        201487093
BCT178       94         226698167
BCT179       104        222093509
BCT18        31         58194184
BCT180       93         221389007
BCT181       111        224520970
BCT182       94         220173706
BCT183       138        222095932
BCT184       44         84896110
BCT185       161        220699365
BCT186       100        223727909
BCT187       96         223995439
BCT188       95         219439398
BCT189       71         223304376
BCT19        135        235079883
BCT190       129        228001663
BCT191       150        229208112
BCT192       77         216466477
BCT193       11         10188678
BCT194       100        233591727
BCT195       95         219993420
BCT196       133        222280876
BCT197       85         221811199
BCT198       26         92438538
BCT199       119        222185746
BCT2         106        226805638
BCT20        131        231843219
BCT200       151        231715107
BCT201       72         216080650
BCT202       81         120955479
BCT203       111        216184725
BCT204       156        227708035
BCT205       111        220250972
BCT206       89         136614524
BCT207       133        229717687
BCT208       109        213797140
BCT209       111        220064957
BCT21        109        220733955
BCT210       77         222877345
BCT211       19         34014599
BCT212       98         220152536
BCT213       132        227699493
BCT214       126        229823053
BCT215       115        247492878
BCT216       116        229072476
BCT217       35         100612124
BCT218       131        216438017
BCT219       93         226438829
BCT22        212        222430645
BCT220       108        224089005
BCT221       116        221458112
BCT222       65         122261042
BCT223       127        225144984
BCT224       137        258852104
BCT225       100        226684234
BCT226       159        219265722
BCT227       71         116660995
BCT228       123        222422665
BCT229       115        218469346
BCT23        50         66104168
BCT230       89         219209021
BCT231       103        229936404
BCT232       104        209481600
BCT233       104        234499310
BCT234       94         222201735
BCT235       95         222593575
BCT236       105        225137188
BCT237       98         229933616
BCT238       106        224550172
BCT239       90         192942285
BCT24        174        220036188
BCT240       104        221826114
BCT241       108        221051727
BCT242       98         226007841
BCT243       76         270744187
BCT244       75         254647899
BCT245       101        225874656
BCT246       178        218571314
BCT247       132        228118798
BCT248       58         111799670
BCT249       303        275292038
BCT25        157        217996559
BCT250       119        219435892
BCT251       114        219246925
BCT252       53         88783408
BCT253       89         220099828
BCT254       87         228427298
BCT255       82         236651858
BCT256       106        224032415
BCT257       39         81227217
BCT258       60         216868170
BCT259       120        221119124
BCT26        52         221902715
BCT260       86         223426276
BCT261       85         217663772
BCT262       31         72411893
BCT263       157        275025230
BCT264       82         232627723
BCT265       84         220566907
BCT266       144        212385076
BCT267       20         28670539
BCT268       109        262921422
BCT269       72         217635148
BCT27        110        224934926
BCT270       100        214909619
BCT271       79         210171996
BCT272       143        306547296
BCT273       72         239204396
BCT274       88         216728836
BCT275       131        224161084
BCT276       140        264048514
BCT277       50         101444202
BCT278       146        273570514
BCT279       114        257004034
BCT28        204        233470802
BCT280       35         229012536
BCT281       60         215899496
BCT282       112        219135997
BCT283       126        219604182
BCT284       95         249332001
BCT285       78         222741730
BCT286       14         34821419
BCT287       124        215159011
BCT288       98         220607386
BCT289       65         210721442
BCT29        3          27676824
BCT290       137        230450043
BCT291       114        227067240
BCT292       109        229190301
BCT293       88         225088899
BCT294       80         141524915
BCT295       107        223678318
BCT296       82         218642004
BCT297       95         229902920
BCT298       97         183022758
BCT299       93         235647841
BCT3         37542      125814925
BCT30        83         236556551
BCT300       104        235928514
BCT301       69         223063860
BCT302       105        213496548
BCT303       119        216777827
BCT304       166        226651969
BCT305       161        212763762
BCT306       157        238023030
BCT307       8          17431560
BCT308       101        230275411
BCT309       119        225277295
BCT31        96         221838262
BCT310       156        250483403
BCT311       117        235914627
BCT312       10         46450140
BCT313       123        226718502
BCT314       112        212578426
BCT315       91         227407856
BCT316       111        218543332
BCT317       153        221137906
BCT318       155        212286893
BCT319       119        183827081
BCT32        96         219800168
BCT320       127        225491526
BCT321       106        222744013
BCT322       83         218273834
BCT323       70         215964942
BCT324       123        196813336
BCT325       87         241506031
BCT326       110        227814029
BCT327       82         219259803
BCT328       52         214399303
BCT329       90         197873444
BCT33        117        236937870
BCT330       113        220728285
BCT331       129        231228144
BCT332       125        212458214
BCT333       94         219289732
BCT334       148        223216642
BCT335       3          10254404
BCT336       124        248813935
BCT337       110        222498371
BCT338       82         228432498
BCT339       61         221300332
BCT34        50         70336694
BCT340       89         186048729
BCT341       128        238885544
BCT342       201        232731845
BCT343       144        217080977
BCT344       134        215029591
BCT345       118        217111970
BCT346       41         76975466
BCT347       139        245503240
BCT348       169        279754521
BCT349       165        215010867
BCT35        83         218320760
BCT350       135        218768734
BCT351       19         125140083
BCT352       72         229560250
BCT353       126        238154065
BCT354       742        221695520
BCT355       398        217882477
BCT356       95         232152237
BCT357       6          15239951
BCT358       115        224523179
BCT359       120        214271004
BCT36        105        222970569
BCT360       102        211428284
BCT361       127        217681230
BCT362       188        233278336
BCT363       230        225229102
BCT364       129        223160743
BCT365       75         164588533
BCT366       136        222929134
BCT367       146        220643724
BCT368       142        217749525
BCT369       131        229168171
BCT37        82         232936682
BCT370       145        233120869
BCT371       97         238465297
BCT372       59         129171418
BCT373       113        227348795
BCT374       143        228415697
BCT375       133        230301712
BCT376       143        217787195
BCT377       84         228448881
BCT378       13         27883457
BCT379       130        230534195
BCT38        119        235544692
BCT380       118        226122673
BCT381       80         223238517
BCT382       91         225542391
BCT383       58         219031718
BCT384       50         220953317
BCT385       132        225967417
BCT386       48         19128392
BCT387       200        233036939
BCT388       127        252087880
BCT389       114        227136753
BCT39        187        254336335
BCT390       215        225277178
BCT391       74         105630813
BCT392       90         239192530
BCT393       114        247991308
BCT394       46         214210162
BCT395       53         216377196
BCT396       19         73275105
BCT397       128        213375994
BCT398       113        228373833
BCT399       72         224187533
BCT4         41290      139250707
BCT40        162        235716785
BCT400       133        247411727
BCT401       182        232684152
BCT402       114        216401796
BCT403       112        219464033
BCT404       62         126238712
BCT405       184        265248059
BCT406       184        238017458
BCT407       299        227349707
BCT408       123        230691656
BCT409       155        239989579
BCT41        162        285723804
BCT410       116        236526519
BCT411       105        221043801
BCT412       16         25750290
BCT413       109        230735808
BCT414       84         216238233
BCT415       94         218004732
BCT416       102        226314622
BCT417       155        220876767
BCT418       68         123957640
BCT419       89         221294643
BCT42        104        224210141
BCT420       108        228032164
BCT421       120        225520882
BCT422       153        335842367
BCT423       110        218250059
BCT424       101        285163697
BCT425       55         131018393
BCT426       116        223524149
BCT427       153        221386449
BCT428       100        220428149
BCT429       94         224434864
BCT43        131        230640010
BCT430       157        223587766
BCT431       118        230273588
BCT432       119        221798255
BCT433       82         94432839
BCT434       122        226585208
BCT435       153        219365274
BCT436       149        229541054
BCT437       159        230173281
BCT438       131        218220461
BCT439       21         41744019
BCT44        34         67043870
BCT440       130        238739741
BCT441       144        219192263
BCT442       141        221558368
BCT443       99         219564845
BCT444       92         213102293
BCT445       106        227602274
BCT446       122        242875742
BCT447       100        313072351
BCT448       88         215834731
BCT449       101        137773450
BCT45        164        221117526
BCT450       123        217943213
BCT451       125        223387893
BCT452       93         216431058
BCT453       101        256544346
BCT454       67         188984278
BCT455       118        212264610
BCT456       113        224096535
BCT457       110        224785936
BCT458       118        216093672
BCT459       46         87010523
BCT46        182        226510942
BCT460       144        219919128
BCT461       104        251665529
BCT462       156        212575427
BCT463       159        212139624
BCT464       12         11443917
BCT465       238        214458452
BCT466       129        214250986
BCT467       99         218510804
BCT468       117        230291203
BCT469       123        262063092
BCT47        249        222464459
BCT470       78         178549235
BCT471       103        236047200
BCT472       127        236790346
BCT473       131        219550029
BCT474       104        228221181
BCT475       91         216460991
BCT476       53         217868736
BCT477       81         148217592
BCT478       165        216872086
BCT479       119        219438729
BCT48        138        188825985
BCT480       114        229553940
BCT481       134        213504721
BCT482       11         41867039
BCT483       78         220992704
BCT484       139        212603090
BCT485       157        216271864
BCT486       317        213898340
BCT487       364        210657095
BCT488       132        214358054
BCT489       129        214345921
BCT49        117        219700493
BCT490       138        211643808
BCT491       186        222281010
BCT492       151        212756765
BCT493       79         104966745
BCT494       161        208257957
BCT495       162        212193463
BCT496       114        210605338
BCT497       157        213126972
BCT498       132        209356669
BCT499       131        195243107
BCT5         20642      162919204
BCT50        154        231749228
BCT500       183        210687290
BCT501       116        210811583
BCT502       136        211510245
BCT503       167        220748430
BCT504       55         112883059
BCT505       156        239757304
BCT506       132        228642948
BCT507       212        229686477
BCT508       114        221407292
BCT509       13         30166462
BCT51        179        217496436
BCT510       112        230828773
BCT511       126        221442497
BCT512       130        232586607
BCT513       108        234490322
BCT514       116        96570292
BCT515       107        232838404
BCT516       96         224202359
BCT517       110        224180420
BCT518       69         230451487
BCT519       119        247887479
BCT52        207        219674506
BCT520       111        267612902
BCT521       71         144393115
BCT522       184        216765022
BCT523       123        232248162
BCT524       132        222732283
BCT525       118        215196560
BCT526       193        220065332
BCT527       123        225435430
BCT528       141        225643357
BCT529       2          9711339
BCT53        147        157984357
BCT530       98         244806965
BCT531       140        231132901
BCT532       93         213640233
BCT533       144        216096685
BCT534       52         79482139
BCT535       140        218732960
BCT536       109        225107446
BCT537       89         216531385
BCT538       160        227565367
BCT539       100        79332059
BCT54        150        229244957
BCT540       157        237479776
BCT541       137        340179435
BCT542       129        246757216
BCT543       188        271554474
BCT544       127        219640401
BCT545       70         232305542
BCT546       113        219878224
BCT547       29         90299175
BCT548       119        220313347
BCT549       89         220615423
BCT55        132        216086617
BCT550       91         230065071
BCT551       118        220710534
BCT552       114        215070730
BCT553       145        214781258
BCT554       22         34118909
BCT555       125        216431578
BCT556       139        217127904
BCT557       127        231713695
BCT558       120        216867760
BCT559       285        221512732
BCT56        81         221931886
BCT560       63         80282166
BCT561       139        228155956
BCT562       96         240199682
BCT563       86         218203266
BCT564       170        210933694
BCT565       134        217729188
BCT566       175        209625406
BCT567       79         96733079
BCT568       156        208447709
BCT569       127        240984651
BCT57        109        222406832
BCT570       128        222248609
BCT571       160        221935754
BCT572       96         151677122
BCT573       160        225500184
BCT574       50         213452168
BCT575       230        254160025
BCT576       132        234547809
BCT577       90         221019009
BCT578       128        191258602
BCT579       153        215988330
BCT58        113        228094449
BCT580       126        276622167
BCT581       205        209499795
BCT582       142        249238352
BCT583       98         257053887
BCT584       10         28305238
BCT585       126        229963741
BCT586       143        224119815
BCT587       143        228055648
BCT588       99         220513805
BCT589       100        221827976
BCT59        93         224120142
BCT590       14         36127315
BCT591       123        221651394
BCT592       130        226062430
BCT593       103        221052628
BCT594       100        222269888
BCT595       94         218107342
BCT596       125        230964292
BCT597       48         128546625
BCT598       128        228496151
BCT599       146        223925807
BCT6         2600       37759883
BCT60        502        112470026
BCT600       166        215804467
BCT601       151        224697554
BCT602       117        221724909
BCT603       112        194039034
BCT604       206        242745918
BCT605       115        230743055
BCT606       183        208573489
BCT607       96         221504128
BCT608       73         229935992
BCT609       163        214524829
BCT61        5200       7533877
BCT610       156        178907953
BCT611       118        219970257
BCT612       61         208926431
BCT613       58         212720835
BCT614       96         227347619
BCT615       163        211364382
BCT616       46         141537947
BCT617       83         216322242
BCT618       94         212424978
BCT619       162        239996086
BCT62        10402      13141863
BCT620       196        290109228
BCT621       68         134048239
BCT622       134        222118709
BCT623       42         214577135
BCT624       37         214639852
BCT625       169        234699017
BCT626       64         148941997
BCT627       93         213934681
BCT628       94         215092310
BCT629       111        222844906
BCT63        53921      202024569
BCT630       144        220055980
BCT631       1          3804066
BCT632       96         215824553
BCT633       117        217349806
BCT634       91         215441587
BCT635       125        214278124
BCT636       58         50622662
BCT637       125        221173811
BCT638       105        243553672
BCT639       112        219526221
BCT64        185        208765651
BCT640       116        225797430
BCT641       56         68232735
BCT642       113        234776612
BCT643       131        215059389
BCT644       132        215446490
BCT645       109        305361100
BCT646       119        389226149
BCT647       37         89297409
BCT648       103        315044090
BCT649       132        215840869
BCT65        101        231004346
BCT650       130        216288700
BCT651       128        225312427
BCT652       116        189016502
BCT653       132        214807403
BCT654       146        211344811
BCT655       157        218339452
BCT656       131        227463680
BCT657       150        284425536
BCT658       96         111912110
BCT659       117        217993852
BCT66        122        221744163
BCT660       101        220308758
BCT661       85         219851191
BCT662       176        273793462
BCT663       12         37505206
BCT664       167        228607581
BCT665       142        234882570
BCT666       129        216056427
BCT667       313        216930339
BCT668       100        219463728
BCT669       11         23786760
BCT67        105        223658793
BCT670       153        253634546
BCT671       117        220928082
BCT672       114        220243493
BCT673       145        215912655
BCT674       128        209612221
BCT675       55         80905256
BCT676       114        208287954
BCT677       111        218909223
BCT678       178        210684333
BCT679       138        220364043
BCT68        132        225901521
BCT680       68         39649747
BCT681       137        242501423
BCT682       146        212177855
BCT683       99         226813904
BCT684       184        224843837
BCT685       76         171603231
BCT686       128        218013642
BCT687       163        236987131
BCT688       149        233234431
BCT689       95         223094380
BCT69        121        221767226
BCT690       153        216702829
BCT691       15         33023684
BCT692       121        216371427
BCT693       144        235531916
BCT694       189        230516470
BCT695       57         212158620
BCT696       54         213861014
BCT697       102        213303998
BCT698       85         213343638
BCT699       121        213119277
BCT7         1310       133308362
BCT70        143        222824414
BCT700       85         222314307
BCT701       84         234274068
BCT702       88         203519746
BCT703       170        215443584
BCT704       147        221075478
BCT705       334        213083661
BCT706       58         212224764
BCT707       72         224728661
BCT708       187        254744920
BCT709       151        222165008
BCT71        144        225008783
BCT710       24         63588680
BCT711       73         212371616
BCT712       92         217821699
BCT713       107        224242047
BCT714       140        207591800
BCT715       138        210023829
BCT716       34         63064456
BCT717       142        206612759
BCT718       117        213883354
BCT719       136        219396034
BCT72        132        146571992
BCT720       80         217057439
BCT721       97         179738098
BCT722       122        220472990
BCT723       85         241011219
BCT724       83         219160791
BCT725       139        229008424
BCT726       114        209823386
BCT727       115        228573543
BCT728       104        180087813
BCT729       104        223025233
BCT73        255        227294457
BCT730       106        217782989
BCT731       123        226271822
BCT732       137        243256026
BCT733       53         88148326
BCT734       107        217566484
BCT735       74         218950444
BCT736       120        225051478
BCT737       145        214500516
BCT738       88         111987983
BCT739       86         213573894
BCT74        86         220119558
BCT740       130        217540925
BCT741       123        210871336
BCT742       171        239325822
BCT743       118        223254380
BCT744       118        212305147
BCT745       61         103694457
BCT746       90         210404774
BCT747       68         218117704
BCT748       78         215089705
BCT749       170        206703246
BCT75        113        224688543
BCT750       90         212853708
BCT751       91         205774211
BCT752       150        220495306
BCT753       74         209792743
BCT754       67         208772721
BCT755       169        212721867
BCT756       56         116045619
BCT757       130        220379388
BCT758       150        212561762
BCT759       122        208757280
BCT76        128        222273877
BCT760       141        218623226
BCT761       71         120622855
BCT762       143        232831805
BCT763       167        218748651
BCT764       262        219114964
BCT765       93         238194838
BCT766       132        210704841
BCT767       146        269013799
BCT768       13         26087527
BCT769       98         208485006
BCT77        135        219988879
BCT770       100        210533604
BCT771       82         210000879
BCT772       135        209511382
BCT773       128        222695129
BCT774       85         214544139
BCT775       122        204382829
BCT776       17         62866914
BCT777       128        230171908
BCT778       113        212211634
BCT779       117        217176695
BCT78        111        162805198
BCT780       126        204798555
BCT781       127        209019053
BCT782       126        217197760
BCT783       2          2874374
BCT784       123        211751375
BCT785       133        205963114
BCT786       123        199946665
BCT787       109        202839658
BCT788       105        200392301
BCT789       46         59924951
BCT79        136        223054995
BCT790       96         210680253
BCT791       102        215577489
BCT792       126        215817254
BCT793       90         206369463
BCT794       167        210992359
BCT795       195        258965701
BCT796       119        231103861
BCT797       109        210143469
BCT798       131        217704792
BCT799       194        242616899
BCT8         191        234251938
BCT80        112        217399067
BCT800       105        221956996
BCT801       115        214870077
BCT802       77         109323484
BCT803       125        211065306
BCT804       122        213122123
BCT805       81         220648324
BCT806       88         217954742
BCT807       19         71723256
BCT808       118        208676078
BCT809       151        208821074
BCT81        131        223635367
BCT810       168        227462150
BCT811       86         215601192
BCT812       9          50951519
BCT813       78         221812250
BCT814       125        223032976
BCT815       136        225597849
BCT816       170        218721653
BCT817       37         58721844
BCT818       144        208238457
BCT819       87         213429706
BCT82        121        221481204
BCT820       101        217399008
BCT821       122        206947282
BCT822       86         218856604
BCT823       41         73711142
BCT824       129        204889894
BCT825       101        206403455
BCT826       140        206673674
BCT827       103        222681205
BCT828       119        203963977
BCT829       89         218799196
BCT83        138        232661918
BCT830       131        207240191
BCT831       86         243483204
BCT832       92         217110281
BCT833       120        204571763
BCT834       267        330723151
BCT835       3          3861503
BCT836       80         212236513
BCT837       42         216832260
BCT838       45         207609867
BCT839       33         216612314
BCT84        108        225781339
BCT840       35         209868915
BCT841       29         204617914
BCT842       38         208164840
BCT843       42         210485019
BCT844       44         211051572
BCT845       38         212223550
BCT846       22         149998670
BCT847       48         210451747
BCT848       40         209817027
BCT849       53         216171741
BCT85        38         50860113
BCT850       42         210660307
BCT851       35         212502390
BCT852       3          19426947
BCT853       50         214605937
BCT854       51         211812861
BCT855       52         210023927
BCT856       56         216125499
BCT857       60         210424088
BCT858       6          33897440
BCT859       47         212007461
BCT86        95         230912422
BCT860       54         215909714
BCT861       50         213554838
BCT862       49         213263466
BCT863       7          35840570
BCT864       39         216577772
BCT865       36         216150585
BCT866       46         213466951
BCT867       38         209902179
BCT868       9          43244600
BCT869       44         214561662
BCT87        117        227983621
BCT870       52         212949917
BCT871       49         212995495
BCT872       39         214973231
BCT873       48         217211812
BCT874       35         159130592
BCT875       32         212769851
BCT876       46         210260903
BCT877       55         212164559
BCT878       49         214983300
BCT879       113        222641659
BCT88        160        232898310
BCT880       64         79318788
BCT881       96         220160568
BCT882       138        246607249
BCT883       117        234489358
BCT884       106        215203074
BCT885       75         176543406
BCT886       130        206130775
BCT887       99         216262761
BCT888       132        209024743
BCT889       146        232106166
BCT89        154        221704284
BCT890       148        212976662
BCT891       53         74260790
BCT892       98         210426593
BCT893       119        210398752
BCT894       103        238874264
BCT895       90         217207547
BCT896       84         206836362
BCT897       43         84419270
BCT898       146        230130694
BCT899       257        224571901
BCT9         133        236750743
BCT90        128        238275556
BCT900       105        230226623
BCT901       68         207912503
BCT902       8          28049535
BCT903       38         205943556
BCT904       40         208182310
BCT905       141        206631333
BCT906       102        213591656
BCT907       32         44307499
BCT908       150        219617638
BCT909       129        230665747
BCT91        114        230664549
BCT910       184        217564262
BCT911       143        214196903
BCT912       137        212881820
BCT913       1          7092945
BCT914       109        214927660
BCT915       230        212909813
BCT916       130        207789667
BCT917       95         201627013
BCT918       33         208554139
BCT919       139        210071272
BCT92        54         123393656
BCT920       63         64908925
BCT921       142        208438983
BCT922       137        257147365
BCT923       92         204593264
BCT924       109        213617047
BCT925       74         205146894
BCT926       81         181353068
BCT927       103        243832933
BCT928       146        211812689
BCT929       155        229580318
BCT93        300        239582260
BCT930       145        224336587
BCT931       117        209471651
BCT932       43         70023048
BCT933       144        226846865
BCT934       165        240804894
BCT935       137        203302520
BCT936       116        206724862
BCT937       8          20181809
BCT938       99         227572136
BCT939       122        208880584
BCT94        142        231562727
BCT940       72         221220782
BCT941       103        223417327
BCT942       5          10099927
BCT943       97         215224235
BCT944       133        213074013
BCT945       166        241766167
BCT946       83         215204606
BCT947       96         148262514
BCT948       154        256565973
BCT949       160        215520838
BCT95        354        225466658
BCT950       227        198139332
BCT951       194        214164016
BCT952       150        238466321
BCT953       183        214004217
BCT954       115        231244324
BCT955       84         84489215
BCT956       267        221230052
BCT957       105        198582168
BCT958       157        198577520
BCT959       111        216079526
BCT96        110        222922994
BCT960       58         205365498
BCT961       126        194755999
BCT962       132        204137212
BCT963       218        208821287
BCT964       91         214185377
BCT965       131        218273982
BCT966       90         213365816
BCT967       66         215010028
BCT968       24         89083167
BCT969       72         216882544
BCT97        120        208517065
BCT970       77         206821532
BCT971       116        212317257
BCT972       149        202431016
BCT973       99         208380995
BCT974       125        217303903
BCT975       25         67523714
BCT976       102        220914310
BCT977       132        203436790
BCT978       129        204375074
BCT979       103        214791358
BCT98        120        227476688
BCT980       163        211740668
BCT981       21         47297581
BCT982       73         214650101
BCT983       86         223702639
BCT984       97         206763127
BCT985       127        199796444
BCT986       63         73275462
BCT987       113        204388700
BCT988       141        204601292
BCT989       134        217690282
BCT99        99         226611423
BCT990       136        210543891
BCT991       126        180689856
BCT992       107        242505953
BCT993       136        210453521
BCT994       115        256551995
BCT995       91         210048481
BCT996       72         320427022
BCT997       16         55088322
BCT998       190        322204163
BCT999       178        306151071
ENV1         189935     141862471
ENV10        83         219720293
ENV11        123        233168356
ENV12        160        211753504
ENV13        78         217974652
ENV14        75001      200284245
ENV15        164232     120901464
ENV16        218957     102557787
ENV17        176354     159883932
ENV18        19607      17093160
ENV19        204685     124198548
ENV2         107540     182340808
ENV20        186311     145969593
ENV21        209227     131010830
ENV22        180832     144716759
ENV23        1253       1680771
ENV24        155432     156521079
ENV25        244834     67513554
ENV26        92644      21374075
ENV27        220959     118335235
ENV28        255263     109061723
ENV29        205148     126323456
ENV3         107534     190935055
ENV30        27436      25911781
ENV31        152286     158743065
ENV32        201174     103412499
ENV33        68234      51315191
ENV34        213266     108913712
ENV35        170980     153756120
ENV36        135003     163680006
ENV37        11565      15756086
ENV38        179911     128295039
ENV39        218036     118475194
ENV4         123        288587808
ENV40        78544      41744926
ENV41        143978     97999834
ENV42        100614     112273801
ENV43        130608     80421746
ENV44        173932     138863702
ENV45        163623     139549512
ENV46        179878     114643421
ENV47        200965     107345641
ENV48        196346     109547800
ENV49        111595     97826521
ENV5         82         223082810
ENV50        158036     134815523
ENV51        145069     136773586
ENV52        169158     47812980
ENV53        172152     133099110
ENV54        210920     100423911
ENV55        142453     62215787
ENV56        216484     84261358
ENV57        212738     92633350
ENV58        108072     43434401
ENV59        224249     98772107
ENV6         113        218427071
ENV60        224778     91719263
ENV61        142977     92510405
ENV62        198338     110961572
ENV63        182989     90540711
ENV64        183046     120492196
ENV65        56546      44849913
ENV66        130925     184596597
ENV67        222730     136081982
ENV68        234258     94804834
ENV69        97664      44643021
ENV7         70         214282206
ENV70        194508     112018451
ENV71        131103     170964472
ENV72        67598      134769130
ENV73        41601      215300471
ENV74        137248     143694176
ENV75        80013      189575188
ENV76        47179      225510654
ENV77        121901     208180310
ENV78        87665      295987188
ENV79        1049       380331571
ENV8         20         65472971
ENV80        1053       383361624
ENV81        688        391877182
ENV82        751        390664475
ENV83        916        392687310
ENV84        153        55401057
ENV85        443        393951292
ENV86        427        391732837
ENV87        1056       391791633
ENV88        1068       392685879
ENV89        68         47794770
ENV9         76         217162029
ENV90        507        386789577
ENV91        495        393960280
ENV92        754        393494364
ENV93        813        390896220
ENV94        730        393266141
ENV95        12621      145211819
EST1         152675     59068774
EST10        155732     67102548
EST100       9280       6073374
EST101       152751     76457993
EST102       144974     99269788
EST103       145182     85226207
EST104       148851     93102880
EST105       7590       4379704
EST106       149588     109398421
EST107       135202     99317177
EST108       136259     97455014
EST109       136242     94833807
EST11        163524     69167407
EST110       2430       1604588
EST111       136737     77265728
EST112       176402     105751785
EST113       193937     119219957
EST114       236932     141668239
EST115       6644       4079812
EST116       229453     127643708
EST117       181415     102870914
EST118       190249     93414076
EST119       5248       4073334
EST12        150868     64813535
EST120       148552     100253258
EST121       154735     119130491
EST122       166280     97900067
EST123       22063      15461205
EST124       130028     82530428
EST125       83543      30920786
EST126       36769      12485692
EST127       84106      31034635
EST128       84264      34515269
EST129       33711      11378339
EST13        186630     83471161
EST130       85031      32709177
EST131       82017      34968192
EST132       83454      35266094
EST133       84118      32965334
EST134       14468      5903340
EST135       83460      51063090
EST136       173481     87480434
EST137       170361     77647991
EST138       145260     91618093
EST139       29926      18954860
EST14        104811     47840316
EST140       140082     86844098
EST141       149390     97854038
EST142       157158     78701962
EST143       181287     92625427
EST144       9191       5349082
EST145       141523     76012752
EST146       151524     73200135
EST147       148374     86976403
EST148       155585     83483584
EST149       12068      7116900
EST15        197325     111627306
EST150       166215     102160051
EST151       202194     107310927
EST152       158867     93286369
EST153       102222     51075859
EST154       155639     79042501
EST155       135075     80133731
EST156       141690     88158876
EST157       165810     85752287
EST158       9314       5218716
EST159       178955     104146744
EST16        147207     104727496
EST160       218711     94419121
EST161       145779     85813988
EST162       161375     87629602
EST163       3062       1523802
EST164       140641     82381870
EST165       132518     83737464
EST166       147240     88253080
EST167       146470     80724455
EST168       20660      10474074
EST169       117769     61073260
EST17        156583     83438215
EST170       115690     61941713
EST171       122419     54128062
EST172       121107     48630686
EST173       29423      11431564
EST174       122215     48678047
EST175       125709     48482605
EST176       165795     83310643
EST177       172205     75576921
EST178       24657      15513157
EST179       147743     104364925
EST18        190948     116798416
EST180       163429     99358064
EST181       205284     116217156
EST182       167108     93350542
EST183       154079     103286743
EST184       134219     92993843
EST185       10781      6013701
EST186       146582     94120876
EST187       154988     80945678
EST188       131921     71038778
EST189       160841     90602190
EST19        177401     113022813
EST190       13426      8488348
EST191       148840     87645185
EST192       153698     95464921
EST193       175523     99185391
EST194       140423     77123132
EST195       5092       4172247
EST196       123957     64267925
EST197       162713     90845821
EST198       173188     99607451
EST199       149613     92840164
EST2         157282     60511000
EST20        71002      55723226
EST200       6220       3898334
EST201       164742     79129501
EST202       122492     84332359
EST203       163357     96332572
EST204       163858     96045573
EST205       14397      6880168
EST206       5847       2580354
EST207       111150     63073430
EST208       151159     87089869
EST209       107205     63530208
EST21        194366     109128304
EST210       164131     100717476
EST211       168271     124553548
EST212       82827      67366748
EST213       186242     95036481
EST214       145260     90138733
EST215       87567      65796037
EST216       141914     85219333
EST217       137886     75147497
EST218       95616      30688109
EST219       146890     86264843
EST22        179786     92385104
EST220       148591     82458987
EST221       141362     94229070
EST222       155415     90007104
EST223       9715       6818730
EST224       161771     99542731
EST225       154058     93650716
EST226       123359     88321639
EST227       146028     90245814
EST228       6976       4224742
EST229       128831     82021098
EST23        107425     50568912
EST230       127856     89666249
EST231       44462      31954010
EST232       156429     83331488
EST233       167399     92029721
EST234       166930     92691445
EST235       158125     88082990
EST236       163896     91508682
EST237       163228     92242200
EST238       166033     91294921
EST239       154891     85088026
EST24        190972     61390762
EST240       168030     90687163
EST241       187909     98489047
EST242       191300     107036253
EST243       168392     100329485
EST244       180025     103224685
EST245       190025     112759300
EST246       186323     113230756
EST247       178010     115392887
EST248       7071       5607359
EST249       140634     86212237
EST25        136527     39211071
EST250       212632     138839121
EST251       226959     111340152
EST252       164069     113913134
EST253       183146     95756964
EST254       197974     98471029
EST255       123046     89289573
EST256       7475       5185523
EST257       140192     82346312
EST258       206166     112637179
EST259       162529     106400163
EST26        102354     27619605
EST260       93617      92298032
EST261       15407      20057289
EST262       147622     99189632
EST263       150767     89756528
EST264       139175     101742302
EST265       216335     99352819
EST266       4567       2822870
EST267       133615     96419482
EST268       129478     90281514
EST269       135531     98318385
EST27        201338     85169852
EST270       113347     81422479
EST271       17537      11116930
EST272       136224     84348047
EST273       125703     85851017
EST274       127789     96576509
EST275       36548      26163923
EST276       126643     89388805
EST277       116504     79027537
EST278       138883     83664868
EST279       145960     114900779
EST28        19821      8893541
EST280       15616      11047942
EST281       125395     117388350
EST282       132433     98775254
EST283       162337     97562555
EST284       165664     104470663
EST285       19257      12070221
EST286       142230     92433803
EST287       168916     115087168
EST288       151692     103908519
EST289       136286     103145259
EST29        203801     100091766
EST290       3504       2324257
EST291       159549     97229973
EST292       222526     90766361
EST293       152836     111325212
EST294       160398     71766467
EST295       10511      1188715
EST296       208917     37980980
EST297       212285     83331327
EST298       150079     115258622
EST299       168109     97764449
EST3         156018     54727708
EST30        216481     109022941
EST300       154827     103149238
EST301       169052     109970400
EST302       149395     109822175
EST303       2197       1476231
EST304       180744     102235132
EST305       178556     93090463
EST306       168973     109471713
EST307       158897     104102902
EST308       2412       1924660
EST309       225880     106203457
EST31        153855     67071563
EST310       266222     115902028
EST311       185438     112102082
EST312       151098     28711854
EST313       227985     99544771
EST314       175491     100305859
EST315       156178     99890381
EST316       159724     95007108
EST317       501        378403
EST318       166298     114042738
EST319       179944     95179284
EST32        149562     63751558
EST320       143781     97257990
EST321       188320     110423173
EST322       187351     49127557
EST323       201668     33862026
EST324       174164     95391760
EST325       14783      9236867
EST326       158235     113265480
EST327       184738     110428476
EST328       167428     97750567
EST329       165965     109745188
EST33        165159     65680081
EST330       165847     71373897
EST331       127635     80037094
EST332       121223     80447816
EST333       146636     101328568
EST334       22504      8264161
EST335       250611     26632520
EST336       254708     23392212
EST337       152004     94195783
EST338       152251     98608210
EST339       150976     99681932
EST34        146995     64488245
EST340       145898     92253111
EST341       237629     43480316
EST342       185640     80872134
EST343       4027       4970633
EST344       168740     99735080
EST345       164066     101174105
EST346       145573     92691954
EST347       189424     103120774
EST348       156183     109749641
EST349       153279     101584306
EST35        162533     70849732
EST350       2503       944448
EST351       184230     108290864
EST352       169884     94656881
EST353       169139     105194404
EST354       178670     59730057
EST355       195269     72030896
EST356       194748     75388710
EST357       197291     74551080
EST358       134728     70211808
EST359       174807     127367579
EST36        160843     65992517
EST360       148311     85036907
EST361       150468     86648232
EST362       121487     94878394
EST363       6016       4765678
EST364       142701     94368059
EST365       154898     94011344
EST366       162129     90206822
EST367       156746     100297355
EST368       24221      10619332
EST369       45656      24624838
EST37        107940     33682334
EST370       155293     104537031
EST371       137832     97018853
EST372       158224     101866180
EST373       152627     109640383
EST374       30457      25940091
EST375       173528     146728187
EST376       163544     85444380
EST377       127571     80894386
EST378       137822     94036599
EST379       51338      35949456
EST38        99513      30490013
EST380       131619     88276056
EST381       136937     89484345
EST382       139330     96988271
EST383       147110     97086473
EST384       51460      41224894
EST385       164148     86536266
EST386       143623     81414337
EST387       144917     86069192
EST388       144188     103734681
EST389       155671     93199334
EST39        99154      31398751
EST390       137838     87384737
EST391       132358     84149156
EST392       20621      12735139
EST393       196942     107257732
EST394       136851     75001285
EST395       92969      54570705
EST396       120408     80237774
EST397       23482      14313208
EST398       131137     82988342
EST399       119642     76596711
EST4         142973     56363489
EST40        98816      29787153
EST400       147271     80746668
EST401       210375     82563334
EST402       30535      12824521
EST403       163628     84364287
EST404       163914     99171502
EST405       159146     95828757
EST406       125949     81273885
EST407       12201      7996192
EST408       129505     86703580
EST409       137395     90180185
EST41        39237      11600444
EST410       178556     111879524
EST411       154174     93122560
EST412       27981      12146305
EST413       166699     91995576
EST414       168828     124880457
EST415       87410      56148447
EST416       69678      41105952
EST417       34127      16800877
EST418       137385     79881208
EST419       82558      49493964
EST42        101326     31351096
EST420       139666     56831391
EST421       148165     29997368
EST422       148030     30296289
EST423       162446     79992545
EST424       28505      15128716
EST425       201162     115815918
EST426       237754     108749461
EST427       220179     107490326
EST428       127131     74523185
EST429       128057     85803248
EST43        102633     36243427
EST430       131704     80409324
EST431       93228      56881081
EST432       174105     110064955
EST433       213136     84698644
EST434       106574     28506785
EST435       183471     112008437
EST436       203905     111386178
EST437       180307     106396407
EST438       199637     118042696
EST439       132935     62223660
EST44        95475      48218258
EST440       110330     60167533
EST441       162601     108614110
EST442       181152     115720728
EST443       108077     86015819
EST444       177004     139599957
EST445       150295     90619060
EST446       54250      34510266
EST447       166056     106956443
EST448       178219     101078638
EST449       42963      24524631
EST45        121121     52335541
EST450       195466     106587863
EST451       183935     94237774
EST452       52147      38920690
EST453       189910     115818986
EST454       180010     117991294
EST455       54575      33990107
EST456       196573     133887305
EST457       219857     123775014
EST458       190087     126956582
EST459       189241     147388649
EST46        55810      33167886
EST460       310        264791
EST461       204237     155999097
EST462       192186     115130551
EST463       160758     96336999
EST464       181197     94914003
EST465       7455       618615
EST466       53496      4381716
EST467       158232     12239421
EST468       144975     12987161
EST469       147925     29931089
EST47        176556     89017465
EST470       148356     29501756
EST471       8452       1761940
EST472       148043     30264080
EST473       141212     81174487
EST474       171367     100066875
EST475       161649     110829124
EST476       19450      13804348
EST477       160769     92760687
EST478       150651     104122645
EST479       133679     93215490
EST48        158182     65087932
EST480       141645     98058798
EST481       16408      8460433
EST482       157369     103673906
EST483       146437     105286243
EST484       162008     97559403
EST485       165795     50905340
EST486       11911      1871822
EST487       160476     40344382
EST488       150806     102149648
EST489       146637     96518392
EST49        162218     91937040
EST490       170921     112346527
EST491       21820      11821661
EST492       132527     75702844
EST493       189749     107907416
EST494       149390     109146835
EST495       53584      36369591
EST496       126855     87064282
EST497       144984     89957424
EST498       147215     88443431
EST499       163143     89171042
EST5         162051     62593707
EST50        154881     80581826
EST500       37742      19234949
EST501       151785     92116569
EST502       155952     91949431
EST503       168251     101940332
EST504       136389     85423858
EST505       15950      9025714
EST506       100253     71169364
EST507       78626      60620272
EST508       97407      64699787
EST509       143235     80400824
EST51        156390     74771983
EST510       37443      21334080
EST511       120626     73365540
EST512       133392     87396068
EST513       135163     79259009
EST514       151533     92857854
EST515       47048      25601310
EST516       155600     85748129
EST517       184596     110426846
EST518       120081     78936396
EST519       178679     94921106
EST52        108219     61222574
EST520       5747       2182136
EST521       52576      18674859
EST522       182569     100663650
EST523       152147     81321151
EST524       23054      13929447
EST525       162316     94446797
EST526       211236     123658554
EST527       30185      19341621
EST528       147958     99624045
EST529       158446     97595891
EST53        153906     88947034
EST530       134305     87490150
EST531       128605     87865201
EST532       26182      16357153
EST533       178675     74362205
EST534       179100     79391228
EST535       198856     83506649
EST536       194861     80609089
EST537       4095       1379666
EST538       178841     95307232
EST539       174076     102227567
EST54        154180     84961596
EST540       180191     107920861
EST541       172258     103856477
EST542       196663     126493129
EST543       186411     103110933
EST544       178906     82833431
EST545       148085     94327161
EST546       206518     125003286
EST547       205657     126701639
EST548       188926     108266858
EST549       208317     121345654
EST55        152206     92215407
EST550       34317      17820709
EST551       154052     96415299
EST552       188314     117673697
EST553       166534     98815170
EST554       133848     98340892
EST555       8680       7064950
EST556       157219     92146041
EST557       170364     84880278
EST558       149242     85152820
EST559       151161     81931931
EST56        150043     69980186
EST560       11910      7120648
EST561       156480     79964955
EST562       181225     106297481
EST563       162168     102988489
EST564       175034     107729396
EST565       4112       2835985
EST566       170705     117072637
EST567       183779     113546740
EST568       129220     83791155
EST569       168573     97321671
EST57        142162     76714634
EST570       185674     110165295
EST571       39431      26359140
EST572       204465     119127975
EST573       269500     91747576
EST574       25706      9441749
EST575       262208     83553217
EST576       157843     95706673
EST577       156061     104112677
EST578       162590     58135365
EST579       92204      36397534
EST58        151708     83217855
EST59        161193     65787331
EST6         166230     65027190
EST60        144593     70135006
EST61        160363     89937947
EST62        150328     92590364
EST63        150104     99262027
EST64        157594     94518660
EST65        2750       1159006
EST66        154746     103409939
EST67        162946     83001350
EST68        166590     84837766
EST69        142361     77842398
EST7         163847     67729347
EST70        148303     82498115
EST71        148974     86076496
EST72        148443     92215211
EST73        150507     87391920
EST74        3383       2003436
EST75        29919      18235506
EST76        186623     102758272
EST77        170455     90769208
EST78        212135     115450370
EST79        179537     103352293
EST8         161030     67846589
EST80        2595       1769868
EST81        196745     121640362
EST82        167531     93331870
EST83        135983     63275222
EST84        128088     62608076
EST85        11211      5755351
EST86        150319     92587484
EST87        154530     96911701
EST88        130224     66330046
EST89        140145     89262488
EST9         169413     69378292
EST90        14643      7628096
EST91        183459     91893008
EST92        204450     119806817
EST93        202065     108012137
EST94        192053     90423413
EST95        203798     86996774
EST96        145870     86936148
EST97        137781     84685372
EST98        158915     76749677
EST99        51         43963
GSS1         172818     126565512
GSS10        15074      14542328
GSS100       156116     139401502
GSS101       16660      10968419
GSS102       168722     143967545
GSS103       157878     109069542
GSS104       156130     106446313
GSS105       152737     105718247
GSS106       168006     122784077
GSS107       149452     126270618
GSS108       161684     125096048
GSS109       186495     115926183
GSS11        145624     106562569
GSS110       16919      10327274
GSS111       185687     119751799
GSS112       201287     103923207
GSS113       219830     124101551
GSS114       87638      57037950
GSS115       151982     114076675
GSS116       155174     118808984
GSS117       155138     118870658
GSS118       163305     106817350
GSS119       37490      21563377
GSS12        199531     104011022
GSS120       179013     131661113
GSS121       189765     117491847
GSS122       166053     55057548
GSS123       169938     76249060
GSS124       3108       2065491
GSS125       161448     105035511
GSS126       188861     124688564
GSS127       200296     82002210
GSS128       168220     79987296
GSS129       137268     94431217
GSS13        191750     84122684
GSS130       129855     104605133
GSS131       132043     108777560
GSS132       132451     106048276
GSS133       8056       5958858
GSS134       135214     112032054
GSS135       56598      47104660
GSS136       132584     107786768
GSS137       139149     116140565
GSS138       140043     114408742
GSS139       138251     109584898
GSS14        173813     89348940
GSS140       4155       2820771
GSS141       134784     106426486
GSS142       134049     108003847
GSS143       134400     111531585
GSS144       138188     116474348
GSS145       4675       3643453
GSS146       139468     108106612
GSS147       136810     113648547
GSS148       136898     113473892
GSS149       137299     112649085
GSS15        1938       988004
GSS150       559        466085
GSS151       137155     110923756
GSS152       134480     106278327
GSS153       133002     107665198
GSS154       138659     116136290
GSS155       1985       1674795
GSS156       127182     92203837
GSS157       174121     105055718
GSS158       184364     110063775
GSS159       162423     108623596
GSS16        167949     83915468
GSS160       177518     102495753
GSS161       195395     128347977
GSS162       201539     133261442
GSS163       200715     134061851
GSS164       181019     126535857
GSS165       198341     136948587
GSS166       196713     139067120
GSS167       196064     138671402
GSS168       174299     134354206
GSS169       144455     97326934
GSS17        159733     81434570
GSS170       138044     80504279
GSS171       165318     73488234
GSS172       130318     57968790
GSS173       162971     140972883
GSS174       170923     113504023
GSS175       80882      52990649
GSS176       191836     128985792
GSS177       195995     117721523
GSS178       29060      15232802
GSS179       180225     98140530
GSS18        155954     85598323
GSS180       181302     123365801
GSS181       178800     126906476
GSS182       181098     127179984
GSS183       19114      12799890
GSS184       165902     130533276
GSS185       170769     155442034
GSS186       219492     123624062
GSS187       216568     103419657
GSS188       17938      8362456
GSS189       210015     95106166
GSS19        153562     95948361
GSS190       162425     134536276
GSS191       16879      16812210
GSS192       125540     102753347
GSS193       122235     93469471
GSS194       156641     154268782
GSS195       167926     158459909
GSS196       131396     104305071
GSS197       149270     107882813
GSS198       170062     141598521
GSS199       173837     119784937
GSS2         172571     106974251
GSS20        153654     72719206
GSS200       20915      12139581
GSS201       181326     133978343
GSS202       184901     120110360
GSS203       180115     93024445
GSS204       172840     121730733
GSS205       189431     117159380
GSS206       189632     116856204
GSS207       21296      12387505
GSS208       200656     130020228
GSS209       215713     142627344
GSS21        106599     59132134
GSS210       217639     140378671
GSS211       166383     136378793
GSS212       152394     108659129
GSS213       159516     120127536
GSS214       159222     144721751
GSS215       159808     141641241
GSS216       160025     145012269
GSS217       161623     143744366
GSS218       162207     142682743
GSS219       161901     124660013
GSS22        132522     64635660
GSS220       168118     139542770
GSS221       162158     116272085
GSS222       180642     88789528
GSS223       2275       1543221
GSS224       251369     52150506
GSS225       262481     40466091
GSS226       262523     40408947
GSS227       122800     38229504
GSS228       253355     52912344
GSS229       182564     86129082
GSS23        125192     56723722
GSS230       188824     55951827
GSS231       154341     118464759
GSS232       177033     144334259
GSS233       160566     145786280
GSS234       158963     146486119
GSS235       175119     110481562
GSS236       238210     57319690
GSS237       198716     101419694
GSS238       228399     39423474
GSS239       119553     74879314
GSS24        133968     72981771
GSS240       173527     111778918
GSS241       148016     90087402
GSS242       140463     83787484
GSS243       159730     149647691
GSS244       6510       5539956
GSS245       112668     95722541
GSS246       180351     149222837
GSS247       172952     122406011
GSS248       201906     127716686
GSS249       188212     120277412
GSS25        142794     74274291
GSS250       166174     94402794
GSS251       159865     84500494
GSS252       156428     119869610
GSS253       203515     148105610
GSS254       14311      9406937
GSS255       171523     67875770
GSS256       176316     96175653
GSS257       195480     152066346
GSS258       199052     153893384
GSS259       8581       7079434
GSS26        12574      5388027
GSS260       197610     157072181
GSS261       197570     124238096
GSS262       194874     142538969
GSS263       853        588710
GSS264       214431     131244295
GSS265       189953     57620998
GSS266       211774     108913136
GSS267       177797     157192397
GSS268       163847     150141472
GSS269       233829     131848785
GSS27        140896     65655631
GSS270       241255     120361822
GSS28        159847     79832355
GSS29        156451     92519127
GSS3         138091     115757733
GSS30        164864     85230462
GSS31        10282      5319388
GSS32        171961     102867176
GSS33        182793     109077642
GSS34        182265     87041537
GSS35        173003     102201943
GSS36        190487     103919871
GSS37        162239     112347665
GSS38        160362     98313234
GSS39        173083     108442870
GSS4         140070     112435838
GSS40        4467       3211536
GSS41        183985     122974505
GSS42        181741     117322404
GSS43        52286      27335335
GSS44        177820     102905200
GSS45        164518     141969870
GSS46        179633     148569334
GSS47        139686     92499212
GSS48        182873     132017102
GSS49        181617     114554523
GSS5         12740      9526334
GSS50        204428     116967955
GSS51        185581     99459566
GSS52        211954     108037045
GSS53        211747     108318359
GSS54        197283     132772792
GSS55        158243     124832316
GSS56        185581     139403239
GSS57        196772     63137399
GSS58        171739     96410996
GSS59        157709     106163169
GSS6         152750     116376137
GSS60        23373      13575160
GSS61        166615     156644394
GSS62        177188     98818477
GSS63        161235     115245018
GSS64        172262     112292681
GSS65        175437     118749924
GSS66        184317     127706706
GSS67        205680     128787401
GSS68        187487     111746271
GSS69        904        494120
GSS7         170822     119987739
GSS70        200507     134082593
GSS71        215979     158545254
GSS72        188980     137988156
GSS73        173702     107612445
GSS74        198148     111946385
GSS75        140507     76313882
GSS76        163068     95818066
GSS77        10997      7015314
GSS78        159270     97756741
GSS79        159481     96970229
GSS8         177085     108879970
GSS80        172278     114346124
GSS81        170756     109404389
GSS82        174393     122413259
GSS83        188868     105212708
GSS84        174781     125776724
GSS85        164186     106495287
GSS86        1893       1501037
GSS87        189248     108544814
GSS88        180902     113819623
GSS89        166588     117808805
GSS9         141918     118720967
GSS90        192391     105665595
GSS91        10240      5928398
GSS92        213831     107550639
GSS93        226833     89047322
GSS94        213068     138993481
GSS95        183490     92580894
GSS96        94686      37020965
GSS97        193805     75823638
GSS98        201086     123394316
GSS99        191020     122180795
HTC1         41190      63371632
HTC2         32318      72271528
HTC3         32081      77888423
HTC4         84853      50691912
HTC5         129489     161175080
HTC6         125374     123224002
HTC7         137565     130734996
HTC8         68695      61912595
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2972       383122016
HTG6         2          386956
HTG60        885        128384665
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3186       360427818
HTG68        3128       367889098
HTG69        2913       377859052
HTG7         2327       375791086
HTG70        1846       312468258
HTG71        3415       365492036
HTG72        2071       381329139
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3218       384021459
HTG8         1500       384347777
HTG80        2165       384532378
HTG81        3034       373211752
HTG82        2133       233393918
HTG9         1582       384062276
INV1         154322     140062712
INV10        4          353796308
INV100       19         393479571
INV100       3          146110617
INV100       10         369487108
INV100       12         390659631
INV100       23         390394397
INV100       25         366663447
INV100       15         378170753
INV100       12         180879245
INV100       22         392034752
INV100       12         386348701
INV100       10         373953727
INV101       18         363756879
INV101       6          388811552
INV101       25         386609090
INV101       13         334938607
INV101       3          236174852
INV101       5          333202408
INV101       7          380888452
INV101       6          288483784
INV101       3          359596411
INV101       3          275853845
INV101       5          376167017
INV102       5          243308800
INV102       7          369632890
INV102       15         378314108
INV102       17         368087933
INV102       5          133748391
INV102       20         388296339
INV102       17         379457536
INV102       20         368530964
INV102       5          394539175
INV102       1          71901920
INV102       6          370194894
INV103       39         334947085
INV103       8          316109534
INV103       1          2140038457
INV103       1          1533311695
INV103       1          991394496
INV103       1          709211797
INV103       1          559013835
INV103       1          538612828
INV103       1          476618521
INV103       1          348474640
INV103       1          332259893
INV104       16         388094550
INV104       1          287425978
INV104       1          237816702
INV104       1          222571878
INV104       2          391571136
INV104       8          340292240
INV104       1          47220557
INV104       4          366546274
INV104       12         379725079
INV104       19         391162514
INV104       10         240269750
INV105       15         286886243
INV105       19         374616646
INV105       33         382987660
INV105       33         386339958
INV105       30         353746939
INV105       21         371601066
INV105       6          362567176
INV105       13         390937191
INV105       12         231701502
INV105       27         388004708
INV105       229        382141802
INV106       1          276873094
INV106       33         392005379
INV106       11         192522327
INV106       20         349696121
INV106       9          386500094
INV106       11         373924042
INV106       9          250287188
INV106       16         392208593
INV106       30         375590146
INV106       20         381850848
INV106       9          220479775
INV107       1          234867409
INV107       3          349443465
INV107       3          121655962
INV107       1          378734160
INV107       1          272287048
INV107       6          307813224
INV107       29         391276627
INV107       16         383716194
INV107       34         374759466
INV107       5          262281928
INV107       11         371329702
INV108       1          301373441
INV108       6          368879584
INV108       7          350337011
INV108       14         345060509
INV108       28         376473495
INV108       20         387688055
INV108       25         387549397
INV108       16         273291927
INV108       21         391659234
INV108       15         388003948
INV108       17         392782098
INV109       1          299223332
INV109       22         384497843
INV109       1          384599746
INV109       1          375927842
INV109       5          382993214
INV109       19         385797313
INV109       11         123214675
INV109       3          392646952
INV109       11         381074049
INV109       23         391735799
INV109       18         390168307
INV11        6          363887313
INV110       1          264325503
INV110       2          42007124
INV110       17         349645545
INV110       36         391559871
INV110       15         393037217
INV110       17         380153622
INV110       3          59787137
INV110       18         391697154
INV110       18         366312255
INV110       3          337894111
INV110       4          302073392
INV111       1          233496210
INV111       2          299644653
INV111       2          270514050
INV111       3          389949835
INV111       3          377785151
INV111       1          117072231
INV111       7          379476447
INV111       13         370594929
INV111       19         385355871
INV111       19         310143194
INV111       24         379964624
INV112       1          211810051
INV112       23         389484464
INV112       18         384799792
INV112       11         311697054
INV112       19         385416179
INV112       23         381933246
INV112       21         387246911
INV112       4          249799159
INV112       2          366882438
INV112       14         388370346
INV112       21         372413558
INV113       1          189869738
INV113       11         364644469
INV113       9          299858585
INV113       3          322474280
INV113       5          373079097
INV113       6          253444959
INV113       1          278847389
INV113       2          381917736
INV113       5          382304965
INV113       10         386062363
INV113       10         259701476
INV114       4          368008555
INV114       13         376291971
INV114       17         379702260
INV114       14         391466716
INV114       23         381561736
INV114       7          104919562
INV114       17         384568933
INV114       4          354385143
INV114       5          393615696
INV114       5          350509167
INV114       13         170433122
INV115       10         374438952
INV115       41         385022073
INV115       30         380703697
INV115       20         392681339
INV115       13         369303117
INV115       3          121760452
INV115       10         368178692
INV115       15         386351526
INV115       16         393205423
INV115       22         382093519
INV115       5          84901051
INV116       142        363361056
INV116       23         391606292
INV116       19         384186373
INV116       24         387846790
INV116       20         373516354
INV116       4          111080816
INV116       18         393422118
INV116       46         378688286
INV116       19         382845041
INV116       14         380720656
INV116       16         377993913
INV117       1          68716222
INV117       13         388384596
INV117       15         353225248
INV117       10         385225146
INV117       11         273470899
INV117       12         363823232
INV117       18         371293482
INV117       18         391994412
INV117       31         390819384
INV117       6          350425796
INV117       14         392098573
INV118       7          358563110
INV118       29         373609145
INV118       17         389590392
INV118       16         381486986
INV118       15         318246839
INV118       17         388617783
INV118       14         389176964
INV118       29         259715661
INV118       4          364567413
INV118       8          381014917
INV118       2          78434448
INV119       6          345062453
INV119       5          350286208
INV119       2          290331975
INV119       2          278888238
INV119       2          276514222
INV119       2          269676904
INV119       4          363956289
INV119       18         391284265
INV119       12         224045865
INV119       19         391324862
INV119       17         390982751
INV12        9          371306258
INV120       6          376979739
INV120       18         376274198
INV120       19         352401134
INV120       3          302186515
INV120       4          353711471
INV120       5          357741396
INV120       13         382478042
INV120       12         224411599
INV120       17         376440323
INV120       17         366693890
INV120       13         391571027
INV121       6          346027335
INV121       18         382117156
INV121       3          51115388
INV121       24         358079042
INV121       12         377073348
INV121       21         382278417
INV121       30         359479577
INV121       2          70328500
INV121       13         381531391
INV121       10         308545783
INV121       3          357081424
INV122       8          391541735
INV122       3          303625532
INV122       2          181194408
INV122       44         384390297
INV122       33         392079687
INV122       13         343474254
INV122       1          226676804
INV122       1          219059534
INV122       16         385377860
INV122       22         389649401
INV122       14         386739832
INV123       20         390632956
INV123       14         369921279
INV123       1          61636059
INV123       7          366264750
INV123       9          350557811
INV123       15         365667369
INV123       6          378807618
INV123       190        393479694
INV123       10         373214505
INV123       7          128813925
INV123       37         384493639
INV124       28         376951305
INV124       27         388854011
INV124       23         380037898
INV124       28         363846557
INV124       15         377681854
INV124       22         393673783
INV124       9          130141504
INV124       20         389123558
INV124       20         387294169
INV124       14         389119304
INV124       19         379601315
INV125       19         381997075
INV125       23         386448258
INV125       8          389213531
INV125       13         380257717
INV125       204        387365574
INV125       30         392954113
INV125       3          276039202
INV125       2          378921420
INV125       2          303390991
INV125       9          391074667
INV125       16         390694906
INV126       117982     189844892
INV126       12         366488514
INV126       4          325784878
INV126       6          389357642
INV126       9          384120626
INV126       11         376230233
INV126       5          157146748
INV126       15         387407218
INV126       10         372793310
INV126       13         386573559
INV126       15         366464331
INV127       35062      26585717
INV127       25         368796884
INV127       14         394572131
INV127       15         272825452
INV127       16         382028398
INV127       3          377751995
INV127       1          74373700
INV127       6          372848766
INV127       19         392995865
INV127       20         361450650
INV127       18         393654662
INV128       167091     134103522
INV128       27         368630202
INV128       24         392519924
INV128       20         384861097
INV128       24         394625452
INV128       21         320922556
INV128       4          339818558
INV128       6          372821066
INV128       12         375257232
INV128       18         356987095
INV128       14         392597749
INV129       126884     112526766
INV129       21         390274896
INV129       3          43344510
INV129       31         388699035
INV129       27         388119446
INV129       10         369434192
INV129       17         377251515
INV129       4          346682597
INV129       3          85114833
INV129       22         388207738
INV129       17         378212285
INV13        15         383308273
INV130       37136      273256295
INV130       16         392106212
INV130       25         393533165
INV130       6          365268265
INV130       9          317988506
INV130       13         387631941
INV130       19         375812714
INV130       6          360702987
INV130       9          377395012
INV130       315        360903659
INV130       24         386975977
INV131       2779       371575686
INV131       2          20618579
INV131       11         379797353
INV131       7          271219600
INV131       6          392152830
INV131       13         379500142
INV131       21         371433468
INV131       17         381702180
INV131       3          58464932
INV131       8          341593495
INV131       4          370341263
INV132       44         370097884
INV132       5          385484997
INV132       3          361480762
INV132       2          227816091
INV132       3          326627480
INV132       3          179785975
INV132       1          394411929
INV132       1          208357731
INV132       2          387387157
INV132       28         393959523
INV132       241        387119275
INV133       24         379270301
INV133       22         379489872
INV133       23         385909353
INV133       7          124975265
INV133       15         390696136
INV133       18         371915036
INV133       16         382295963
INV133       15         370940962
INV133       8          363964332
INV133       7          216076461
INV133       1          222508353
INV134       5          76533839
INV134       2          378391780
INV134       11         365473561
INV134       4          178163008
INV134       24         386512327
INV134       26         391903437
INV134       36         382490299
INV134       14         376797262
INV134       8          203772100
INV134       21         389229967
INV134       14         386982868
INV135       32         391299062
INV135       19         389026688
INV135       10         374195572
INV135       7          158156167
INV135       15         377259953
INV135       23         388223446
INV135       14         372625691
INV135       19         382678381
INV135       10         189595137
INV135       24         380015923
INV135       20         388962198
INV136       25         362900281
INV136       14         379590905
INV136       13         301439739
INV136       15         378313646
INV136       15         386611886
INV136       23         392780439
INV136       14         300976708
INV136       22         355579415
INV136       6          382504563
INV136       8          311266892
INV136       3          335903695
INV137       18         380479131
INV137       1          91272002
INV137       4          340601518
INV137       5          393178719
INV137       7          378352357
INV137       8          368654020
INV137       3          55757405
INV137       1          219663937
INV137       2          347956425
INV137       5          371419038
INV137       12         376377240
INV138       19         390062857
INV138       16         384236082
INV138       8          176370631
INV138       18         372019888
INV138       24         386509465
INV138       24         389713698
INV138       31         307760477
INV138       5          386523964
INV138       1          28255227
INV138       5          90894419
INV138       1          485851375
INV139       5          134896453
INV139       1          214862200
INV139       8          378994418
INV139       19         376407609
INV139       46         376414438
INV139       3          388122302
INV139       11         318389619
INV139       3          234762902
INV139       2          315919502
INV139       6          393647630
INV139       11         381373389
INV14        23         362467755
INV140       18         373966012
INV140       19         381074705
INV140       22         386497102
INV140       21         390526659
INV140       254        366101051
INV140       12         386296471
INV140       16         387655277
INV140       21         383151662
INV140       20         383401877
INV140       19         344640379
INV140       1          82766246
INV141       24         386584721
INV141       17         385091065
INV141       20         387924663
INV141       12         388536663
INV141       8          219178196
INV141       11         367097380
INV141       13         382777311
INV141       13         359364339
INV141       7          252534006
INV141       7          348359881
INV141       6          327698438
INV142       8          380395300
INV142       2          316788101
INV142       3          312494531
INV142       4          204379861
INV142       1          406294527
INV142       1          310928733
INV142       3          388958877
INV142       11         148169598
INV142       1          249786838
INV142       2          319646621
INV142       5          298110067
INV143       19         379365223
INV143       1          281865375
INV143       1          241717587
INV143       10         375364887
INV143       17         384501009
INV143       11         328663993
INV143       1          106314825
INV143       4          339541539
INV143       7          369695073
INV143       5          344800758
INV143       8          394204524
INV144       9          138772803
INV144       4          119862796
INV144       10         365101424
INV144       18         388033671
INV144       26         393220942
INV144       12         266980887
INV144       19         392458449
INV144       55         389557696
INV144       24         387260689
INV144       13         234291481
INV144       7          258353618
INV145       28         391443580
INV145       2          295700062
INV145       7          366943025
INV145       11         381355472
INV145       4          106561761
INV145       19         343847635
INV145       17         382516650
INV145       2          332743733
INV145       6          313828708
INV145       16         380123343
INV145       45         361967714
INV146       28         392100242
INV146       3          372946856
INV146       7          266485410
INV146       18         382230867
INV146       10         304685791
INV146       3          347667496
INV146       20         363448675
INV146       26         391194852
INV146       9          375785816
INV146       10         364023583
INV146       9          272133891
INV147       45         382097969
INV147       9          363725267
INV147       8          384234607
INV147       10         393372120
INV147       40         329899252
INV147       6          337260709
INV147       5          383946385
INV147       12         302989156
INV147       19         376745921
INV147       15         386872820
INV147       19         377921066
INV148       27         372689086
INV148       21         391511415
INV148       5          268714484
INV148       2          354551436
INV148       1          157299779
INV148       3          175039039
INV148       1          258850354
INV148       2          335699355
INV148       4          247610254
INV148       1          210654766
INV148       2          362253048
INV149       18         385206419
INV149       2          291631295
INV149       2          121261647
INV149       1          373316775
INV149       1          242235330
INV149       1          230154751
INV149       1          215250610
INV149       11         384181851
INV149       21         394628944
INV149       21         388317282
INV149       5          124958072
INV15        29         382177169
INV150       12         373566826
INV150       20         371325954
INV150       17         377167253
INV150       16         316992586
INV150       8          380596977
INV150       3          59344420
INV150       26         368094122
INV150       14         385505339
INV150       18         337616521
INV150       2          326309498
INV150       4          392502457
INV151       1          94407144
INV151       5          316388481
INV151       10         382487467
INV151       14         367500819
INV151       17         393579082
INV151       16         320660384
INV151       5          358120367
INV151       8          361433354
INV151       3          310200528
INV151       16         382164179
INV151       24         382990678
INV152       15         381614547
INV152       14         386676724
INV152       20         389628974
INV152       9          139734111
INV152       30         384304423
INV152       22         379619161
INV152       5          201083147
INV152       1          214309029
INV152       2          362516173
INV152       2          344553920
INV152       2          335374504
INV153       29         387067226
INV153       2          321615305
INV153       2          309892614
INV153       2          295904703
INV153       2          292629611
INV153       2          287511714
INV153       2          281066585
INV153       3          371349787
INV153       23         393225346
INV153       13         347530107
INV153       4          341473635
INV154       25         384930026
INV154       4          373447781
INV154       5          352685990
INV154       20         386769473
INV154       15         361943918
INV154       9          358194592
INV154       11         383437796
INV154       12         371566673
INV154       29         394011208
INV154       28         385746331
INV154       18         302475867
INV155       18         381070342
INV155       4          318142276
INV155       11         388330882
INV155       6          356025686
INV155       25         390407770
INV155       17         150566893
INV155       2          352537966
INV155       2          276070255
INV155       24         393379081
INV155       43         374993362
INV155       23         391094723
INV156       96883      235171769
INV156       26         389040069
INV156       17         334905483
INV156       6          351795300
INV156       13         391964421
INV156       31         333085123
INV156       1          240654870
INV156       1          223236985
INV156       3          226917127
INV156       1          225692979
INV156       1          215602707
INV157       124547     97382534
INV157       2          359154098
INV157       2          283138276
INV157       3          366799603
INV157       3          307774329
INV157       5          386006823
INV157       6          377763960
INV157       17         380578375
INV157       23         179650194
INV157       9          279714746
INV157       1          319955300
INV158       28942      319697553
INV158       4          294686109
INV158       3          364144297
INV158       11         369858529
INV158       26         367540634
INV158       9          377516512
INV158       10         371704098
INV158       12         343109056
INV158       10         354589932
INV158       34         375616881
INV158       19         394326882
INV159       28941      347133943
INV159       21         374608767
INV159       23         392617132
INV159       19         390763580
INV159       21         373694902
INV159       20         389092152
INV159       6          342447720
INV159       6          392638958
INV159       17         377689199
INV159       27         389728640
INV159       22         354327927
INV16        25         391264799
INV160       20         388604938
INV160       14         387821915
INV160       24         384209358
INV160       18         387080188
INV160       27         368588306
INV160       22         392029793
INV160       14         327862994
INV160       19         377119881
INV160       17         307555546
INV160       3          353482681
INV160       5          299619810
INV161       15         389699299
INV161       1          132666048
INV161       3          317464440
INV161       7          393544312
INV161       19         384876011
INV161       22         371202890
INV161       12         198837579
INV161       23         355220600
INV161       10         359923815
INV161       2          335082113
INV161       6          386079520
INV162       16         252138391
INV162       5          230433460
INV162       5          352992863
INV162       5          380688199
INV162       7          352664180
INV162       9          377429293
INV162       12         394660557
INV162       10         197942219
INV162       2          336892074
INV162       3          370983084
INV162       3          332872960
INV163       34         391108680
INV163       1          123574484
INV163       5          334741585
INV163       6          361874674
INV163       1          600392024
INV163       1          498054485
INV163       6          247445165
INV163       3          377166698
INV163       6          380839905
INV163       13         379838352
INV163       18         376311503
INV164       71         392017627
INV164       13         377693108
INV164       3          77407176
INV164       16         290303689
INV164       4          388534210
INV164       7          367452973
INV164       9          347348840
INV164       6          318055136
INV164       2          231996794
INV164       7          379250551
INV164       13         385052985
INV165       24         388974367
INV165       14         392864015
INV165       23         389418814
INV165       24         358524871
INV165       11         358125685
INV165       6          377157459
INV165       5          313090362
INV165       1          203836987
INV165       2          361472882
INV165       7          389230467
INV165       2          66154651
INV166       21         381982755
INV166       19         379925762
INV166       26         382380400
INV166       7          340680974
INV166       11         368263801
INV166       15         378509559
INV166       11         160650367
INV166       3          346301993
INV166       4          227914153
INV166       1          463878994
INV166       1          411919547
INV167       20         377528210
INV167       3          385717261
INV167       9          382692631
INV167       12         390490662
INV167       4          66996290
INV167       3          374261553
INV167       4          259154223
INV167       2          338881051
INV167       2          297311018
INV167       8          367421825
INV167       4          151351292
INV168       24         388990898
INV168       8          326797151
INV168       2          273333741
INV168       4          277445847
INV168       1          262796939
INV168       2          271972204
INV168       1          127864911
INV168       7          367980411
INV168       8          350419278
INV168       8          346802129
INV168       7          388895464
INV169       29         394663938
INV169       6          332687782
INV169       17         389980029
INV169       19         275721668
INV169       2          316756308
INV169       5          378077717
INV169       8          376434480
INV169       22         386292603
INV169       14         359535040
INV169       31         393401082
INV169       23         252185357
INV17        19         392660452
INV170       27         393364046
INV170       21         393889915
INV170       25         385063393
INV170       31         389476731
INV170       28         383285214
INV170       29         383108478
INV170       30         382677493
INV170       4          368098288
INV170       10         361306401
INV170       3          310174203
INV170       5          377713589
INV171       23         381713426
INV171       5          310344155
INV171       5          388826641
INV171       17         355257629
INV171       5          277866332
INV171       7          377579832
INV171       6          331962748
INV171       8          379965026
INV171       6          351494758
INV171       7          325767769
INV171       1          305569956
INV172       137        350719386
INV172       1          202803143
INV172       5          370802707
INV172       20         387233220
INV172       17         383557345
INV172       12         367544820
INV172       15         379680131
INV172       8          367593407
INV172       12         383019718
INV172       8          342062699
INV172       14         347824666
INV173       4          381900476
INV173       1          54263138
INV173       12         355903329
INV173       6          247193371
INV173       2          339071690
INV173       2          311526032
INV173       11         376067292
INV173       15         392012949
INV173       14         382723066
INV173       21         393287380
INV173       30         386815739
INV174       24         389620289
INV174       4          70209508
INV174       20         393833935
INV174       23         371772514
INV174       36         378152407
INV174       7          361576036
INV174       3          144800141
INV174       12         386123069
INV174       18         379682883
INV174       24         376237200
INV174       18         382676377
INV175       33         393229173
INV175       10         136249824
INV175       17         376448086
INV175       24         392500034
INV175       23         358451346
INV175       12         387353786
INV175       9          196688578
INV175       7          352292992
INV175       10         379488587
INV175       22         377064691
INV175       16         383674032
INV176       9          344807465
INV176       5          109367460
INV176       18         286866675
INV176       3          347598182
INV176       5          338175262
INV176       4          383058601
INV176       1          247560496
INV176       4          303728199
INV176       1          271964629
INV176       1          239161613
INV176       2          386396440
INV177       23         323415557
INV177       2          162310632
INV177       1          370326948
INV177       3          388116385
INV177       6          377917711
INV177       5          354494059
INV177       7          379606228
INV177       59         240919020
INV177       28         359911917
INV177       7          236235409
INV177       2          379651703
INV178       32         372756064
INV178       2          347329764
INV178       2          321027264
INV178       2          301226685
INV178       1          146202077
INV178       2          275982907
INV178       8          379231808
INV178       13         381766812
INV178       1          195322241
INV178       2          321367667
INV178       2          287611822
INV179       20         384740836
INV179       3          363118937
INV179       151        318674679
INV179       3          211854900
INV179       8          376981019
INV179       7          363245700
INV179       6          378101022
INV179       5          256321261
INV179       18         388042686
INV179       23         382786746
INV179       13         372130825
INV18        20         372860966
INV180       25         385708589
INV180       25         317222528
INV180       1          138004034
INV180       3          360707963
INV180       4          357311906
INV180       5          346948291
INV180       14         370286180
INV180       7          318431914
INV180       26         393842626
INV180       22         386509625
INV180       10         353087157
INV181       29         388680045
INV181       10         387832607
INV181       10         373670327
INV181       4          333077632
INV181       5          364543032
INV181       6          393941015
INV181       6          353983694
INV181       7          378037394
INV181       7          341953960
INV181       10         353005371
INV181       16         394332096
INV182       22         323658394
INV182       34         394329872
INV182       22         222473678
INV182       1          276355679
INV182       1          217944636
INV182       1          197031954
INV182       5          380718072
INV182       2          341485480
INV182       2          308085231
INV182       2          281366780
INV182       3          343008649
INV183       25         386606940
INV183       6          394632706
INV183       73         88563404
INV183       40         393860896
INV183       21         389178549
INV183       23         390279201
INV183       11         366024924
INV183       15         383815095
INV183       6          233774553
INV183       11         318926178
INV183       1          236655262
INV184       22         384360764
INV184       1          228831665
INV184       4          200268325
INV184       1          398148334
INV184       1          396779011
INV184       3          365240166
INV184       1          271406195
INV184       1          240115956
INV184       1          234010456
INV184       1          222850789
INV184       1          222041990
INV185       22         375170759
INV185       1          214774154
INV185       1          208864772
INV185       2          385457695
INV185       1          173785391
INV185       2          328914304
INV185       2          280661178
INV185       3          348023719
INV185       3          321038252
INV185       4          383266743
INV185       4          360652640
INV186       31         394116451
INV186       3          225220179
INV186       5          343830006
INV186       19         391034512
INV186       33         377901333
INV186       3          285907573
INV186       5          365873602
INV186       12         352551386
INV186       13         388990812
INV186       20         378129919
INV186       3          74847337
INV187       20         281624502
INV187       19         384569499
INV187       164        363844843
INV187       25         388002625
INV187       24         394108272
INV187       25         388456233
INV187       7          189882940
INV187       12         374058399
INV187       13         369064937
INV187       22         386405232
INV187       37         341590234
INV188       11         364532943
INV188       21         382080792
INV188       35         387100104
INV188       24         340374351
INV188       6          390070066
INV188       2          355024036
INV188       2          342960507
INV188       2          311494261
INV188       2          295519746
INV188       1          135025151
INV188       3          379490009
INV189       14         378464462
INV189       11         379372791
INV189       7          359888950
INV189       16         378789259
INV189       24         394107320
INV189       34         392989145
INV189       5          21585147
INV189       22         324895239
INV189       2          299186257
INV189       6          362460712
INV189       9          387111328
INV19        37320      262524560
INV190       38         390437780
INV190       11         368255149
INV190       7          355492621
INV190       2          292929496
INV190       3          371024363
INV190       6          379490557
INV190       20         390841565
INV190       18         386207184
INV190       22         382636201
INV190       20         361837808
INV190       3          116327985
INV191       20         259303673
INV191       11         374473831
INV191       15         350435315
INV191       5          353354685
INV191       9          376025838
INV191       22         394234238
INV191       9          294558694
INV191       3          302830112
INV191       4          392502765
INV191       4          347773011
INV191       5          368661550
INV192       35         382133951
INV192       3          265935754
INV192       2          347754842
INV192       3          382935602
INV192       4          342994718
INV192       3          276023194
INV192       2          276520271
INV192       13         383729738
INV192       6          132365555
INV192       22         376117024
INV192       21         384065815
INV193       38912      329097860
INV193       22         384355100
INV193       19         386550730
INV193       12         219074331
INV193       11         372633943
INV193       26         394076679
INV193       19         194735070
INV193       1          225226363
INV193       1          206506613
INV193       2          394396855
INV193       2          356850941
INV194       150888     102332908
INV194       2          319268338
INV194       2          306867190
INV194       2          284173246
INV194       2          273112872
INV194       3          356273435
INV194       26         393213294
INV194       15         343475066
INV194       4          393371353
INV194       16         386588044
INV194       20         390518809
INV195       33152      23772372
INV195       3          63486690
INV195       7          381885577
INV195       6          333293152
INV195       8          381680885
INV195       32         385557513
INV195       1          268738192
INV195       1          198165196
INV195       2          332727274
INV195       2          300381557
INV195       3          370469178
INV196       149053     103687585
INV196       19         387777686
INV196       10         178759522
INV196       16         316379498
INV196       2          313326125
INV196       2          290442673
INV196       2          268501743
INV196       2          265074071
INV196       1          131156662
INV196       3          369122587
INV196       3          354263792
INV197       152017     116270196
INV197       3          321235536
INV197       4          391689094
INV197       1          95440512
INV197       4          369504425
INV197       4          336085252
INV197       5          378466390
INV197       6          372816724
INV197       8          219343940
INV197       13         344941026
INV197       15         380996558
INV198       122371     84062369
INV198       23         275387129
INV198       3          347720517
INV198       6          343951003
INV198       8          370855222
INV198       13         378708468
INV198       15         377380168
INV198       12         390673203
INV198       3          185863584
INV198       7          376004104
INV198       18         289651850
INV199       154868     113573322
INV199       2          280521886
INV199       39         370507765
INV199       19         381996014
INV199       5          78439562
INV199       8          73497269
INV199       1          333366068
INV199       1          315088429
INV199       23         392086749
INV199       12         394366138
INV199       13         371312745
INV2         2292       316573060
INV20        129080     165753959
INV200       153312     120334655
INV200       7          118554082
INV200       1          540902015
INV200       1          497146285
INV200       2          330852102
INV200       2          307739636
INV200       24         393207303
INV200       13         310792642
INV200       7          372201851
INV200       9          379781793
INV200       2          75545352
INV201       54970      36684477
INV201       12         369904671
INV201       11         230690062
INV201       1          229430737
INV201       2          345099040
INV201       2          323143075
INV201       2          239411081
INV201       193        387416601
INV201       3          315203386
INV201       4          375274038
INV201       4          339765018
INV202       153084     110237138
INV202       13         368735014
INV202       15         388101236
INV202       15         386904996
INV202       4          350178401
INV202       5          327379525
INV202       4          293768589
INV202       8          390720175
INV202       11         350478746
INV202       6          372656319
INV202       8          372827652
INV203       153409     114899745
INV203       7          312827126
INV203       4          361968338
INV203       7          339834966
INV203       6          372062175
INV203       8          377486639
INV203       13         369569036
INV203       19         394219669
INV203       2          152436959
INV203       7          363134464
INV203       10         386347312
INV204       39199      33980745
INV204       3          335627890
INV204       11         389470032
INV204       5          385610870
INV204       2          300019394
INV204       2          265039893
INV204       3          373013123
INV204       3          328449850
INV204       5          379569712
INV204       4          338322175
INV204       2          139397890
INV205       141663     88564268
INV205       6          353558504
INV205       12         384314845
INV205       21         288502782
INV205       3          315914524
INV205       3          120094563
INV205       1          372685034
INV205       1          307400245
INV205       1          253737357
INV205       1          252426069
INV205       8          374880074
INV206       147687     93924004
INV206       26         382508937
INV206       3          377658906
INV206       19         392915017
INV206       22         303279447
INV206       29         384608396
INV206       15         211696759
INV206       1          311103460
INV206       1          307551131
INV206       9          388916524
INV206       15         260619519
INV207       44892      33924593
INV207       12         376072474
INV207       1          461908344
INV207       1          427865198
INV207       6          389250555
INV207       9          192108800
INV207       22         381300126
INV207       12         376387644
INV207       18         384659512
INV207       17         384031361
INV207       28         319884169
INV208       148164     97364723
INV208       1          76070991
INV208       6          348308341
INV208       15         394136312
INV208       22         382992187
INV208       12         357032699
INV208       17         390511797
INV208       16         379182564
INV208       14         348451180
INV208       15         376276846
INV208       8          384702289
INV209       139419     81636055
INV209       4          142595804
INV209       14         386059102
INV209       22         393487207
INV209       21         382000406
INV209       11         372882714
INV209       16         364444719
INV209       1          122546896
INV209       6          377956717
INV209       22         382460928
INV209       26         390282377
INV21        207        346774014
INV210       42868      25415260
INV210       20         317303269
INV210       17         382570375
INV210       9          331323617
INV210       2          343893327
INV210       5          369952675
INV210       1          71685601
INV210       22         385376258
INV210       26         352711703
INV210       7          394065018
INV210       30         377811522
INV211       138614     82881238
INV211       14         387559243
INV211       19         372702026
INV211       15         382221601
INV211       18         291199017
INV211       29         388601290
INV211       12         383509635
INV211       12         375548108
INV211       11         328422431
INV211       3          362647208
INV211       2          161837360
INV212       138424     82990551
INV212       10         371765599
INV212       11         236051395
INV212       1          316535607
INV212       1          268156038
INV212       1          266481161
INV212       1          217403395
INV212       24         383737014
INV212       19         380164404
INV212       14         358693904
INV212       11         389063827
INV213       52982      35049457
INV213       6          274604271
INV213       4          351378362
INV213       8          264020983
INV213       1          207417819
INV213       2          353449585
INV213       3          391801342
INV213       4          367022431
INV213       9          390256832
INV213       10         372688861
INV213       11         326542526
INV214       139289     83576609
INV214       3          343644368
INV214       1          264795841
INV214       1          260388659
INV214       3          187648385
INV214       1          332497885
INV214       1          246881801
INV214       1          241705591
INV214       1          233035232
INV214       8          373500108
INV214       14         393297487
INV215       135365     98978054
INV215       21         385893798
INV215       26         366214498
INV215       1          530134936
INV215       2          393930877
INV215       2          309944359
INV215       3          391793628
INV215       2          233312597
INV215       3          332336109
INV215       3          314101530
INV215       4          394293045
INV216       74607      58395598
INV216       31         378538997
INV216       6          88769108
INV216       20         388874814
INV216       18         315333486
INV216       2          297091254
INV216       3          371484263
INV216       1          104679623
INV216       4          333520379
INV216       3          387334624
INV216       1          266517024
INV217       142146     107853239
INV217       1          248291630
INV217       1          234708312
INV217       1          231279273
INV217       2          391687663
INV217       3          380107938
INV217       14         390955960
INV217       11         200080428
INV217       12         361936421
INV217       13         384895745
INV217       13         372934070
INV218       149502     121600365
INV218       14         307567254
INV218       27         391249785
INV218       1          309490030
INV218       1          208745215
INV218       2          349949719
INV218       3          181594157
INV218       1          213114244
INV218       13         390706337
INV218       18         390352182
INV218       20         391064963
INV219       155304     117910037
INV219       17         370370848
INV219       13         359247149
INV219       5          233195395
INV219       26         385532547
INV219       27         384434012
INV219       18         332432361
INV219       5          379406296
INV219       7          334065850
INV219       6          387228632
INV219       1          416981589
INV22        93         331307518
INV220       122381     174567319
INV220       1          411700809
INV220       1          374718084
INV220       1          371044941
INV220       1          365984801
INV220       1          352887774
INV220       1          342031869
INV220       1          318622295
INV220       1          293000873
INV220       1          292648081
INV220       1          276841339
INV221       39873      101192110
INV221       1          273120619
INV221       1          263802346
INV221       1          238685547
INV221       11         381347882
INV221       27         292340995
INV221       1          365315121
INV221       1          295723576
INV221       1          293424451
INV221       1          290278928
INV221       2          201180588
INV222       181112     235169059
INV222       1          352804369
INV222       1          335692043
INV222       1          263086104
INV222       1          216567736
INV222       14         372305493
INV222       27         387261075
INV222       3          31545372
INV222       17         197691260
INV222       1          269143606
INV222       1          261529156
INV223       218151     167649786
INV223       2          362612544
INV223       2          314308897
INV223       4          165657604
INV223       27         389528211
INV223       21         184663557
INV223       1          260819945
INV223       1          254310297
INV223       4          346159624
INV223       1          259880515
INV223       1          205072316
INV224       38629      187147326
INV224       2          387897589
INV224       5          391545896
INV224       5          358088864
INV224       3          176731733
INV224       7          364939484
INV224       2          37838460
INV224       1          525849209
INV224       1          480241822
INV224       1          479196665
INV224       1          472419714
INV225       800        42674647
INV225       1          437841927
INV225       1          433825958
INV225       1          428987597
INV225       1          389388581
INV225       1          381007749
INV225       1          348274448
INV225       1          322979321
INV225       1          321891989
INV225       1          316645346
INV225       1          301005785
INV226       566        40635863
INV226       7          388858315
INV226       10         164989793
INV226       14         154315916
INV226       1          382016842
INV226       1          354375104
INV226       1          298339950
INV226       1          279317925
INV226       11         368000574
INV226       11         372683164
INV226       11         238436650
INV227       8037       115580217
INV227       2          312736568
INV227       2          298933566
INV227       2          276750936
INV227       2          274749953
INV227       2          270733333
INV227       3          393991939
INV227       3          371168522
INV227       3          343383639
INV227       3          331951715
INV227       3          317855654
INV228       23265      332345847
INV228       3          303531066
INV228       4          390504887
INV228       4          358327236
INV228       2          161258937
INV228       5          374194520
INV228       12         376225043
INV228       16         382781894
INV228       10         312344892
INV228       3          346479552
INV228       7          360222895
INV229       23319      172531536
INV229       7          371444518
INV229       5          380658375
INV229       7          373393625
INV229       18         334055920
INV229       19         383711867
INV229       12         350773630
INV229       6          267559540
INV229       1          200011560
INV229       2          386963669
INV229       4          313852562
INV23        3          136766944
INV230       67585      303875862
INV230       1          126326439
INV230       3          350930075
INV230       6          393778613
INV230       1          693712867
INV230       1          690419613
INV230       1          688810701
INV230       1          639929110
INV230       1          625027500
INV230       1          623195831
INV230       1          617718696
INV231       121343     264933975
INV231       1          587611834
INV231       1          579867335
INV231       1          570975883
INV231       1          553997549
INV231       1          500834625
INV231       1          472070509
INV231       1          461332996
INV231       1          454322268
INV231       1          14271
INV231       6          379852134
INV232       66775      80327893
INV232       9          359769526
INV232       15         383100693
INV232       20         390343060
INV232       21         392824678
INV232       7          301782665
INV232       5          345594170
INV232       6          380136043
INV232       5          194942959
INV232       1          212714337
INV232       2          354279074
INV233       180562     231780487
INV233       4          345601582
INV233       6          375163100
INV233       9          383477264
INV233       5          199074271
INV233       5          365555370
INV233       11         382497727
INV233       19         387793109
INV233       20         380273396
INV233       15         347167974
INV233       21         374560346
INV234       41599      303967104
INV234       8          391676936
INV234       9          378336352
INV234       10         387572568
INV234       9          316779053
INV234       5          355290915
INV234       8          182974236
INV234       1          368254541
INV234       1          210857651
INV234       2          383968593
INV234       12         389608575
INV235       314        393292454
INV235       4          37106671
INV235       11         376651302
INV235       28         382539755
INV235       23         379355953
INV235       19         302733193
INV235       1          500415566
INV235       1          470534908
INV235       1          357693088
INV235       1          314807154
INV235       5          394125196
INV236       1015       105322314
INV236       17         385533773
INV236       20         354582908
INV236       9          192693427
INV236       1          256751940
INV236       1          252416835
INV236       1          239401621
INV236       1          227695852
INV236       1          226046865
INV236       1          216904698
INV236       1          212630555
INV237       2059       383654064
INV237       1          212420410
INV237       2          391271819
INV237       2          349936877
INV237       2          343277917
INV237       2          300647015
INV237       3          337654472
INV237       8          380584849
INV237       19         387104740
INV237       12         299597539
INV237       2          283707779
INV238       2          41011863
INV238       4          356833896
INV238       6          335112016
INV238       4          333927725
INV238       5          350658811
INV238       13         394239928
INV238       26         375177697
INV238       11         364858162
INV238       2          71048444
INV238       19         392043749
INV238       26         386637710
INV239       591        361654729
INV239       17         363568092
INV239       7          242682687
INV239       2          299965188
INV239       3          385937044
INV239       6          358651860
INV239       11         275532205
INV239       16         373371702
INV239       19         330530206
INV239       3          393218167
INV239       23         392890030
INV24        14         359428768
INV240       8          378508614
INV240       13         322719809
INV240       6          394385071
INV240       7          303524829
INV240       6          360998595
INV240       10         350686916
INV240       9          372424180
INV240       4          333822857
INV240       2          308909484
INV240       12         377249787
INV240       15         351819312
INV241       974        354275690
INV241       2          119938108
INV241       9          373164316
INV241       10         384583714
INV241       10         199858303
INV241       2          292527395
INV241       3          370685756
INV241       2          102671423
INV241       3          388648132
INV241       6          354386610
INV241       13         390558435
INV242       6          380479040
INV242       17         386058075
INV242       13         300042739
INV242       9          345076352
INV242       3          327456098
INV242       4          383120628
INV242       8          394600980
INV242       20         307473029
INV242       11         381286289
INV242       12         392811617
INV242       3          280207396
INV243       2          95552909
INV243       1          269568514
INV243       1          147079922
INV243       25         359567719
INV243       6          385710748
INV243       11         372518283
INV243       16         369696408
INV243       9          215537920
INV243       7          375467400
INV243       10         386632857
INV243       14         393279860
INV244       22         390382246
INV244       3          343925772
INV244       1          99977196
INV244       4          372532975
INV244       4          331465773
INV244       6          344851163
INV244       16         370008491
INV244       2          204305198
INV244       5          342506017
INV244       12         390795302
INV244       16         372744446
INV245       10036      362338941
INV245       11         344819483
INV245       17         392337105
INV245       5          373822918
INV245       6          374347171
INV245       15         385821377
INV245       2          80806228
INV245       13         373946632
INV245       14         388884333
INV245       3          349810089
INV245       1          253425051
INV246       376        361065125
INV246       1          192291135
INV246       2          367797560
INV246       2          300912613
INV246       4          264870547
INV246       8          371327938
INV246       16         380945155
INV246       2          42815412
INV246       15         368316233
INV246       6          365815154
INV246       8          367891023
INV247       200        339574406
INV247       8          364467632
INV247       22         250751733
INV247       20         377627858
INV247       12         231011654
INV247       1          442868002
INV247       1          416293306
INV247       1          378904118
INV247       1          378849418
INV247       3          373804301
INV247       6          370936332
INV248       28         363750328
INV248       9          372000882
INV248       18         380364635
INV248       15         256291129
INV248       8          372400586
INV248       10         285769792
INV248       2          328040175
INV248       3          371579434
INV248       5          388221128
INV248       2          270290477
INV248       3          357116672
INV249       25         362372590
INV249       3          315550310
INV249       4          363215280
INV249       7          367230423
INV249       7          387869069
INV249       6          244727908
INV249       4          350122895
INV249       5          340600640
INV249       7          362029520
INV249       7          386358330
INV249       8          371532205
INV25        9          363281720
INV250       18         224818646
INV250       3          175321154
INV250       3          330193299
INV250       4          386128953
INV250       4          342731255
INV250       6          371518052
INV250       7          228204125
INV250       2          384148414
INV250       2          371158735
INV250       2          298689172
INV250       3          337531854
INV251       552        321019135
INV251       8          383334215
INV251       32         389163326
INV251       10         308877735
INV251       4          370035584
INV251       8          364791053
INV251       9          391699459
INV251       18         382500240
INV251       9          108268135
INV251       1          468439176
INV251       1          472191871
INV252       2          371500015
INV252       1          465949720
INV252       1          462794763
INV252       1          453407184
INV252       1          429722027
INV252       1          412041099
INV252       1          370601896
INV252       1          361191451
INV252       1          295284678
INV252       1          287987902
INV252       1          282215724
INV253       2          289902239
INV253       1          268909579
INV253       1          255424980
INV253       213        394350305
INV253       11         72705422
INV253       23         374077214
INV253       11         379341267
INV253       13         370520558
INV253       16         389023589
INV253       6          73056617
INV253       2          285571836
INV254       2965       358959205
INV254       3          367720399
INV254       3          303257363
INV254       4          392359805
INV254       4          357874430
INV254       33         393085454
INV254       19         381110003
INV254       2          98271311
INV254       11         379939137
INV254       5          311894290
INV254       3          334025954
INV255       59309      333102202
INV255       3          299501991
INV255       4          393095154
INV255       4          372910076
INV255       14         387412155
INV255       21         381602035
INV255       10         392380997
INV255       14         377993322
INV255       21         385471787
INV255       8          371702929
INV255       20         394392347
INV256       34         383065485
INV256       1659       391646041
INV256       52777      104012353
INV257       19         393344928
INV258       14         327270017
INV259       27         393651567
INV26        52         355336707
INV260       32         390738662
INV261       24         383706815
INV262       25         382049854
INV263       31         378115211
INV264       13         297748085
INV265       18         387848062
INV266       24         381271345
INV267       36         390867092
INV268       34         389743485
INV269       26         391141334
INV27        14         371434550
INV270       19         292893418
INV271       11         371260264
INV272       19         391738075
INV273       12         391781067
INV274       13         372901688
INV275       32         389502535
INV276       22         330410978
INV277       29         389284801
INV278       38         387663352
INV279       17         367589223
INV28        78         134821644
INV280       12         387517245
INV281       17         362786034
INV282       10         320557524
INV283       13         376469258
INV284       35         380323776
INV285       26         392110960
INV286       24         388964019
INV287       21         391745060
INV288       22         309540561
INV289       27         392282931
INV29        6          384224499
INV290       24         388632304
INV291       12         375724207
INV292       16         393313708
INV293       13         392068868
INV294       10         277290815
INV295       15         358735036
INV296       11         386907833
INV297       40         377177573
INV298       21         392427759
INV299       5          215849302
INV3         104207     181560657
INV30        14         390998271
INV300       15         382505853
INV301       743        382889760
INV302       26         386022184
INV303       28         394591284
INV304       7          307846648
INV305       4          182170525
INV306       2          342421305
INV307       2          269826459
INV308       18         385786230
INV309       1901       346423954
INV31        25         372322353
INV310       8862       318236250
INV311       11615      311304128
INV312       29313      84782847
INV313       137005     98937413
INV314       129604     76456029
INV315       119657     73654253
INV316       151089     93753585
INV317       144097     102730522
INV318       68760      59330361
INV319       151276     123286643
INV32        19         385290616
INV320       150086     121704452
INV321       87352      71350285
INV322       149076     116311104
INV323       143134     122525125
INV324       103383     125193606
INV325       142136     131919290
INV326       143853     117370087
INV327       103139     176596556
INV328       1880       379192273
INV329       3223       263774757
INV33        27         390539373
INV330       96781      321023124
INV331       217342     232110336
INV332       60949      250981301
INV333       103988     292596017
INV334       28973      364551361
INV335       1764       378352969
INV336       2739       197024699
INV337       184144     268358078
INV338       1785       378880292
INV339       5583       374469857
INV34        34         346107857
INV340       20768      153711624
INV341       288223     205808194
INV342       1224       379793465
INV343       4515       373876603
INV344       92490      210334617
INV345       391527     140904810
INV346       109733     258294965
INV347       80040      286704883
INV348       3569       375757529
INV349       31480      357683960
INV35        4          251686535
INV350       16121      41281259
INV351       298725     199657065
INV352       214334     249067665
INV353       2226       377046597
INV354       19303      366955288
INV355       16948      41978773
INV356       298408     186907243
INV357       1355       379516794
INV358       3687       378313727
INV359       136930     300095839
INV36        3          241225934
INV360       38349      357698579
INV361       664        92151452
INV362       8529       370827851
INV363       197744     256830145
INV364       359558     128682792
INV365       93023      322972837
INV366       2568       378355489
INV367       61847      343439542
INV368       72069      24187260
INV369       120595     77017226
INV37        3          393880593
INV370       94952      39072123
INV371       95293      37117394
INV372       96302      35388473
INV373       95394      37384891
INV374       24011      12775723
INV375       95729      37221065
INV376       110869     72413124
INV377       138861     112768772
INV378       17377      14142808
INV379       141461     135500832
INV38        3          261336042
INV380       148155     115972046
INV381       132627     147941977
INV382       23         379895035
INV383       6          76972734
INV384       15         379655485
INV385       6          355188453
INV386       1          239744465
INV387       1          231634122
INV388       1          221096292
INV389       1          220877407
INV39        3          322765503
INV390       1          216720617
INV391       1          210676062
INV392       2          387811394
INV393       2          329972158
INV394       2          302384449
INV395       20         360081608
INV396       9          301825222
INV397       23         382490317
INV398       23         380735444
INV399       18         387931948
INV4         59786      271809546
INV40        2          265971290
INV400       33         390736486
INV401       795        381170065
INV402       20         391287680
INV403       2          32244328
INV404       27         388830496
INV405       21         386972019
INV406       9          351834369
INV407       5          163634948
INV408       1          292306469
INV409       1          164045107
INV41        4          328757598
INV410       2          318230244
INV411       868        391036523
INV412       30         390895475
INV413       25         383908286
INV414       25         388289419
INV415       3          49480870
INV416       25         384967191
INV417       26         391463882
INV418       22         392427991
INV419       26         383547221
INV42        5          378753109
INV420       26         265978999
INV421       6          371290168
INV422       13         374069663
INV423       19         385560269
INV424       15         373391572
INV425       13         350978987
INV426       22         386100611
INV427       24         386055502
INV428       23         389090030
INV429       31         366704932
INV43        5          371191486
INV430       12         307588661
INV431       24         393914970
INV432       16         362929629
INV433       8          361035446
INV434       13         369493806
INV435       13         384884009
INV436       18         390461886
INV437       22         394170044
INV438       11         336163521
INV439       6          353407420
INV44        4          376987297
INV440       7          372089599
INV441       3          84055545
INV442       9          390327029
INV443       19         393988728
INV444       11         137914990
INV445       1          346874609
INV446       1          248688513
INV447       1          195213701
INV448       21         389226046
INV449       16         380802157
INV45        4          293537168
INV450       17         384888603
INV451       24         390785021
INV452       14         272669524
INV453       19         394017224
INV454       17         391933486
INV455       7          291754234
INV456       2          360067285
INV457       1          158111693
INV458       5          390880948
INV459       1          269711166
INV46        4          373434888
INV460       1          265788494
INV461       5          389225578
INV462       8          84827761
INV463       32         385135770
INV464       29         391336068
INV465       26         380265073
INV466       8          257485661
INV467       20         383534134
INV468       18         388997674
INV469       13         372064491
INV47        42         369246043
INV470       12         246225518
INV471       18         394216238
INV472       18         380558243
INV473       10         378653212
INV474       35         286756574
INV475       57         386542022
INV476       41         394290459
INV477       30         391877099
INV478       23         388833300
INV479       17         384297034
INV48        71         345464815
INV480       310        391634117
INV481       26         381054851
INV482       8          105967983
INV483       29         389236155
INV484       23         387510109
INV485       25         393194949
INV486       29         393406758
INV487       10         389413895
INV488       12         256001243
INV489       25         382453876
INV49        11         126310825
INV490       25         387644779
INV491       17         390017898
INV492       13         185974631
INV493       1          252586203
INV494       2          382245123
INV495       1          170640157
INV496       3          172715237
INV497       1          265601162
INV498       1          235131548
INV499       8          377013040
INV5         86         394210993
INV50        33         389894099
INV500       18         389308576
INV501       6          76294397
INV502       2          316929497
INV503       5          371999024
INV504       13         377525467
INV505       22         380131966
INV506       4          94235370
INV507       20         386111019
INV508       10         330750052
INV509       8          388492156
INV51        24         300399380
INV510       29         385235322
INV511       3          68204675
INV512       1          375708846
INV513       177        377903380
INV514       3          72566929
INV515       18         393806697
INV516       12         375328864
INV517       13         388485421
INV518       17         389690952
INV519       10         355855682
INV52        7          368066952
INV520       12         388165924
INV521       5          66893570
INV522       2          334507981
INV523       2          271847796
INV524       9          384970046
INV525       14         380331769
INV526       17         331062789
INV527       4          353245537
INV528       5          361980503
INV529       1          66459093
INV53        17         353983817
INV530       6          375950524
INV531       11         380698960
INV532       13         393299321
INV533       16         371834617
INV534       4          107829629
INV535       16         390859621
INV536       35         393136677
INV537       18         389411089
INV538       80         348191458
INV539       10         366985680
INV54        7          374779506
INV540       18         382945053
INV541       3          55752453
INV542       23         351194891
INV543       4          361297550
INV544       19         383086968
INV545       16         391635138
INV546       22         382293034
INV547       15         196098011
INV548       12         326431359
INV549       3          345780114
INV55        1          208110490
INV550       4          385052575
INV551       6          392605260
INV552       17         135120912
INV553       1          319032388
INV554       1          282837000
INV555       1          278321370
INV556       1          265031889
INV557       1          264456228
INV558       1          255727343
INV559       1          255305493
INV56        2          302887577
INV560       1          230784347
INV561       9          392641003
INV562       28         356306819
INV563       2          278332741
INV564       8          361353987
INV565       10         379658367
INV566       13         380787037
INV567       8          386860579
INV568       6          361028373
INV569       3          168396230
INV57        3          341397147
INV570       7          375518624
INV571       10         375539956
INV572       5          355133492
INV573       12         346368422
INV574       4          128335036
INV575       18         344289019
INV576       6          343424801
INV577       6          355424926
INV578       9          361129815
INV579       1          209131117
INV58        3          306059974
INV580       2          365485920
INV581       2          326453370
INV582       2          310804349
INV583       3          355594170
INV584       7          341653095
INV585       49         372335313
INV586       6          201861407
INV587       19         385553829
INV588       11         389495243
INV589       41         318939638
INV59        4          375190511
INV590       7          359994759
INV591       11         363361177
INV592       18         352506103
INV593       2          121342079
INV594       11         370878851
INV595       38         392392993
INV596       39         383674587
INV597       29         392907305
INV598       24         381869223
INV599       13         164951452
INV6         84         293302731
INV60        4          333576383
INV600       41         380881169
INV601       15         386326246
INV602       9          137942415
INV603       1          410988561
INV604       2          347081175
INV605       2          60458881
INV606       1          429819325
INV607       1          230177572
INV608       2          394052085
INV609       35         354776612
INV61        5          348361494
INV610       7          318208416
INV611       5          336561253
INV612       7          357043306
INV613       7          262116983
INV614       1          170575982
INV615       2          287036945
INV616       2          275604705
INV617       3          367947227
INV618       3          342256987
INV619       5          256835876
INV62        14         387211070
INV620       13         321847088
INV621       5          332460113
INV622       95         319933371
INV623       12         328718900
INV624       9          217598510
INV625       20         352503315
INV626       9          379049671
INV627       14         374215308
INV628       15         347131978
INV629       3          328312092
INV63        13         392726641
INV630       4          369177951
INV631       3          246468438
INV632       5          376372316
INV633       11         376604103
INV634       17         381822991
INV635       22         391138986
INV636       6          54648714
INV637       12         377183847
INV638       30         388952266
INV639       3          326197890
INV64        66         317360954
INV640       3          271412684
INV641       6          360181556
INV642       18         382522482
INV643       24         379871629
INV644       21         312971658
INV645       22         381784561
INV646       21         380590911
INV647       13         371720425
INV648       17         390781836
INV649       3          78204341
INV65        4          328154363
INV650       17         377301939
INV651       12         357316205
INV652       6          368644317
INV653       9          270151474
INV654       12         189039214
INV655       1          244108438
INV656       1          210424776
INV657       2          347597490
INV658       2          286016373
INV659       2          120783828
INV66        3          230854823
INV660       22         392193755
INV661       13         360806743
INV662       11         375564408
INV663       9          362288897
INV664       3          377576368
INV665       4          158823784
INV666       12         376095937
INV667       6          372905819
INV668       7          388366567
INV669       7          351386075
INV67        5          362121003
INV670       12         377915288
INV671       10         168222845
INV672       21         336280653
INV673       11         387853015
INV674       17         383594904
INV675       12         371624632
INV676       4          205127384
INV677       1          255265360
INV678       1          230794410
INV679       2          372619140
INV68        211        385264302
INV680       2          311523487
INV681       13         393665610
INV682       24         199571394
INV683       2          323510804
INV684       12         381394394
INV685       12         281321844
INV686       6          301645505
INV687       3          327580854
INV688       2          283053804
INV689       4          358883688
INV69        55         389266884
INV690       3          313487646
INV691       12         372628339
INV692       11         296511468
INV693       12         205288598
INV694       1          329103898
INV695       1          266482116
INV696       1          255371252
INV697       1          249620899
INV698       11         381319634
INV699       28         382489592
INV7         170        364968923
INV70        16         251967525
INV700       15         383181010
INV701       13         350686833
INV702       1          90894639
INV703       5          367141834
INV704       4          355766912
INV705       6          390997169
INV706       1          283143227
INV707       7          385962722
INV708       18         390420686
INV709       14         352409616
INV71        24         388112032
INV710       3          310319640
INV711       1          94671628
INV712       4          375545906
INV713       2          330374624
INV714       9          385008187
INV715       36         348936130
INV716       7          362657616
INV717       12         375776805
INV718       21         386373372
INV719       28         385558874
INV72        39         380190174
INV720       2          30875957
INV721       30         377576257
INV722       16         383023174
INV723       25         385163881
INV724       20         289852567
INV725       11         387811488
INV726       13         388478264
INV727       20         388641472
INV728       37         387165660
INV729       14         208952549
INV73        33         379073437
INV730       33         393285708
INV731       13         364621498
INV732       12         378544770
INV733       14         393303348
INV734       17         283001740
INV735       25         393022599
INV736       6          259595995
INV737       2          306898484
INV738       22         392724989
INV739       11         81108636
INV74        87         331766739
INV740       1          334972678
INV741       1          327956322
INV742       4          369938243
INV743       10         387945021
INV744       6          333511012
INV745       3          390034570
INV746       6          388490213
INV747       37         293380102
INV748       3          330508129
INV749       3          304092200
INV75        20         393500649
INV750       4          386935527
INV751       16         364918260
INV752       10         392609098
INV753       30         381546124
INV754       2          331139274
INV755       5          390800394
INV756       2          93184197
INV757       9          363742103
INV758       11         374818742
INV759       13         353874383
INV76        19         386117294
INV760       29         353592845
INV761       6          313902203
INV762       2          325968719
INV763       2          326866526
INV764       2          294862287
INV765       2          277963616
INV766       1          135489923
INV767       5          389105293
INV768       21         334259074
INV769       19         374293438
INV77        20         393838616
INV770       21         257681977
INV771       15         378008119
INV772       18         345890599
INV773       9          374177525
INV774       13         282334662
INV775       13         367448714
INV776       14         383036237
INV777       9          337662876
INV778       4          285079875
INV779       13         380626621
INV78        9          185353717
INV780       20         391060643
INV781       17         236492487
INV782       1          253604678
INV783       1          244180387
INV784       2          385719063
INV785       2          323852856
INV786       3          391496974
INV787       69         343048078
INV788       3          58690555
INV789       1          427500052
INV79        16         368214362
INV790       1          280788551
INV791       1          231232069
INV792       2          365961697
INV793       2          306037738
INV794       2          294194033
INV795       8          383537417
INV796       10         382401646
INV797       15         373941744
INV798       2          278659155
INV799       5          350216916
INV8         5          352575630
INV80        17         373531597
INV800       5          342671345
INV801       7          377861791
INV802       14         385594223
INV803       25         241789371
INV804       2          304382108
INV805       5          380650692
INV806       6          108274197
INV807       30         387029729
INV808       27         330887562
INV809       3          314705854
INV81        17         378099553
INV810       4          344406745
INV811       5          389867528
INV812       5          353121931
INV813       14         392298773
INV814       2          53978732
INV815       17         382363442
INV816       13         374918202
INV817       15         379396417
INV818       103        385952128
INV819       20         386688731
INV82        11         222599361
INV820       18         382007266
INV821       57         153866701
INV822       5          219711870
INV823       2          319873814
INV824       6          380185718
INV825       3          381341903
INV826       1          111009446
INV827       5          379226736
INV828       12         393993623
INV829       22         391120037
INV83        17         378099553
INV830       20         316738233
INV831       1          263587734
INV832       2          374750442
INV833       2          338140745
INV834       2          298578205
INV835       5          384869169
INV836       30         387739996
INV837       13         296449972
INV838       18         279137441
INV839       2          322765580
INV84        18         381766905
INV840       3          390029089
INV841       4          345523436
INV842       2          287481868
INV843       3          368157705
INV844       4          330380185
INV845       2          273986171
INV846       11         380263283
INV847       21         357807916
INV848       12         391993231
INV849       8          369418028
INV85        18         381766905
INV850       9          378821074
INV851       10         378877305
INV852       2          122089777
INV853       7          366744808
INV854       22         393387120
INV855       28         374632208
INV856       17         380406226
INV857       10         104480107
INV858       1          298134333
INV859       6          372478433
INV86        11         244247504
INV860       7          273110839
INV861       1          174811163
INV862       1          246577358
INV863       3          380592957
INV864       8          336515494
INV865       5          388249994
INV866       7          360174377
INV867       8          393835422
INV868       7          326451249
INV869       18         390226185
INV87        18         381766905
INV870       4          212448392
INV871       2          361639366
INV872       11         389090510
INV873       24         261483440
INV874       20         187767331
INV875       1          300440965
INV876       1          255158195
INV877       1          235639307
INV878       1          234027751
INV879       5          364518894
INV88        18         381766905
INV880       1          52122333
INV881       17         394627877
INV882       24         372312688
INV883       5          353472817
INV884       6          348815087
INV885       3          142239958
INV886       10         371554285
INV887       10         389038857
INV888       15         393343847
INV889       354        351174080
INV89        17         378099553
INV890       61         370950558
INV891       13         377490054
INV892       17         362779264
INV893       1          215246178
INV894       1          179976030
INV895       2          326215908
INV896       12         393295794
INV897       17         355147463
INV898       7          364022270
INV899       8          232711543
INV9         7          383441747
INV90        10         214458835
INV900       10         320236834
INV901       5          374560279
INV902       5          347050153
INV903       6          365683735
INV904       8          350757240
INV905       8          330705725
INV906       7          319315304
INV907       8          294380847
INV908       8          300070536
INV909       5          296140165
INV91        17         373531597
INV910       7          321898042
INV911       8          344779364
INV912       5          204172647
INV913       8          363714706
INV914       8          335684798
INV915       7          325614821
INV916       8          343203705
INV917       8          295765726
INV918       4          296872836
INV919       1          277791574
INV92        17         376354888
INV920       2          374437900
INV921       3          384355230
INV922       4          287970803
INV923       8          310860357
INV924       1          87642240
INV925       3          322074102
INV926       5          350860081
INV927       3          341421742
INV928       3          303252646
INV929       3          274953531
INV93        17         378128112
INV930       5          354560190
INV931       4          293401691
INV932       5          291612199
INV933       6          363161146
INV934       7          367190402
INV935       1          63881323
INV936       7          369938164
INV937       24         385109501
INV938       29         371254400
INV939       3          369936174
INV94        11         244218945
INV940       3          324539581
INV941       4          365244967
INV942       5          389493350
INV943       6          394661900
INV944       13         382083182
INV945       31         381763837
INV946       28         392125926
INV947       4          128300843
INV948       4          359450428
INV949       5          357390477
INV95        18         377201651
INV950       10         360971319
INV951       10         388368184
INV952       12         376602273
INV953       78         347723211
INV954       3          159381941
INV955       8          277689252
INV956       2          308292894
INV957       4          378776770
INV958       3          224250587
INV959       2          353669327
INV96        19         384750213
INV960       3          365790299
INV961       5          373092601
INV962       25         383158187
INV963       13         390048803
INV964       10         389033966
INV965       13         387771417
INV966       15         383558849
INV967       8          145928775
INV968       16         387212131
INV969       17         373736547
INV97        19         386574986
INV970       10         387894809
INV971       13         380870662
INV972       36         385258928
INV973       13         163501620
INV974       28         381827489
INV975       22         374847337
INV976       2          310213387
INV977       4          223537066
INV978       1          311186714
INV979       4          305252952
INV98        11         217953999
INV980       1          117261666
INV981       4          325431757
INV982       5          343105299
INV983       8          390057518
INV984       11         390412576
INV985       18         344362951
INV986       4          389304644
INV987       8          374713972
INV988       4          67335450
INV989       1          354881887
INV99        18         390383119
INV990       1          306296502
INV991       2          379020699
INV992       10         369838626
INV993       2          26750373
INV994       1          249865697
INV995       3          387636064
INV996       14         388824602
INV997       16         387485480
INV998       8          379220830
INV999       6          382970618
MAM1         32376      323872706
MAM10        26814      24994146
MAM100       4          359964523
MAM101       4          383777488
MAM102       5          381968701
MAM103       4          345040697
MAM104       3          176472919
MAM105       6          356825309
MAM106       3          354814440
MAM107       3336       333279354
MAM108       67877      268551867
MAM109       99604      191348858
MAM11        13731      20581276
MAM110       38644      138145878
MAM111       1          179953079
MAM112       4          274800947
MAM113       4          294612101
MAM114       4          368804057
MAM115       5          360824188
MAM116       3          381844289
MAM117       4          323611747
MAM118       5          314441637
MAM119       278        273083750
MAM12        3445       7368868
MAM120       1          216965501
MAM121       1          210729441
MAM122       2          349064804
MAM123       2          311803703
MAM124       2          284093331
MAM125       3          348809871
MAM126       4          369368223
MAM127       5          363867118
MAM128       1          61486999
MAM129       391        303038843
MAM13        107        699953
MAM130       2          387082860
MAM131       2          304198725
MAM132       3          374133223
MAM133       3          326166110
MAM134       4          378433792
MAM135       4          343736516
MAM136       26         156134288
MAM137       2          295910882
MAM138       3          365955123
MAM139       3          347352947
MAM14        20         277696380
MAM140       3          322237442
MAM141       4          341689478
MAM142       5          362834364
MAM143       7          390905713
MAM144       3          258595851
MAM145       2          333773690
MAM146       3          387942990
MAM147       3          354718536
MAM148       2          226942227
MAM149       3          311333393
MAM15        1          249270926
MAM150       4          346893067
MAM151       5          358087510
MAM152       7          370527586
MAM153       266        52932980
MAM154       2          381699852
MAM155       2          379453767
MAM156       2          323756069
MAM157       3          363198547
MAM158       2          215864552
MAM159       4          373314142
MAM16        2          343930246
MAM160       5          370562270
MAM161       3          229138897
MAM162       2          357862388
MAM163       1          148378616
MAM164       2          277983130
MAM165       3          347551233
MAM166       3          317094091
MAM167       4          359797234
MAM168       5          367203739
MAM169       2          35182349
MAM17        3          325384739
MAM170       3          344892062
MAM171       3          310823791
MAM172       4          343820600
MAM173       5          380959867
MAM174       5          326724081
MAM175       2          125670854
MAM176       6          349136452
MAM177       5          249014812
MAM178       4          263893466
MAM179       2          255070854
MAM18        1          90795278
MAM180       2          283025985
MAM181       3          333227068
MAM182       3          347405297
MAM183       3          311786266
MAM184       3          370283980
MAM185       3          367382503
MAM186       3          376930704
MAM187       2          186941709
MAM188       1          212679785
MAM189       1          200210433
MAM19        4          322903327
MAM190       2          301321370
MAM191       2          204542634
MAM192       4          342554685
MAM193       6          373951174
MAM194       9          394516191
MAM195       1          178365832
MAM196       2          317576479
MAM197       3          382289813
MAM198       3          333151314
MAM199       4          387058184
MAM2         22271      277087027
MAM20        4          298795355
MAM200       1          88847605
MAM201       5          393069609
MAM202       5          297820775
MAM203       2          370199356
MAM204       2          296330659
MAM205       3          378321649
MAM206       3          341779801
MAM207       4          389646286
MAM208       3          260392119
MAM209       5          252937523
MAM21        6          353843759
MAM210       1          210889723
MAM211       2          390094915
MAM212       3          369279389
MAM213       1          134025529
MAM214       3          382647393
MAM215       3          348525342
MAM216       4          385414949
MAM217       8          367669076
MAM218       3          338644129
MAM219       4          384410696
MAM22        5          329700903
MAM220       4          321255648
MAM221       5          366955574
MAM222       2          129330055
MAM223       6          369468462
MAM224       7          368094007
MAM225       3          278321486
MAM226       2          356989359
MAM227       2          294642091
MAM228       3          374469516
MAM229       3          321593661
MAM23        2          289079565
MAM230       4          372512269
MAM231       5          394669051
MAM232       6          352162926
MAM233       3          338100906
MAM234       3          320896055
MAM235       4          391714968
MAM236       5          389929348
MAM237       161        346315705
MAM238       1          234112155
MAM239       1          222567163
MAM24        3          348530310
MAM240       2          360432915
MAM241       3          330590648
MAM242       4          366004254
MAM243       5          346781633
MAM244       18         241194090
MAM245       1          248793850
MAM246       1          230256221
MAM247       1          228110630
MAM248       2          379305370
MAM249       2          357708012
MAM25        4          336581445
MAM250       2          332346077
MAM251       8          383124560
MAM252       1          188105751
MAM253       2          350144535
MAM254       2          286698385
MAM255       3          356425192
MAM256       3          316253659
MAM257       4          371964282
MAM258       5          393252436
MAM259       4          100914822
MAM26        5          375256260
MAM260       1          217416870
MAM261       1          206141883
MAM262       2          387441900
MAM263       2          314669017
MAM264       2          288652274
MAM265       3          377887044
MAM266       1          108092423
MAM267       4          349510186
MAM268       5          186101589
MAM269       1          209197390
MAM27        6          373952570
MAM270       1          196764438
MAM271       2          292822034
MAM272       4          354472100
MAM273       5          333461393
MAM274       8          295257259
MAM275       3          320447314
MAM276       2          387241361
MAM277       4          374496829
MAM278       5          363097693
MAM279       6          296258101
MAM28        8          377813420
MAM280       42         341927000
MAM281       2          302500556
MAM282       2          245239052
MAM283       2          308701436
MAM284       2          284439369
MAM285       3          238578438
MAM286       2          389306359
MAM287       5          369816620
MAM288       3          332089460
MAM289       3          387381783
MAM29        5          379300313
MAM290       2          242812335
MAM291       3          336751953
MAM292       4          394670760
MAM293       4          337872094
MAM294       5          356954418
MAM295       7          371121970
MAM296       3          384043289
MAM297       1          202113133
MAM298       1          201284082
MAM299       2          383142327
MAM3         2          316219032
MAM30        1          38035513
MAM300       3          365726228
MAM301       6          360549912
MAM302       7          148771979
MAM303       2          365059240
MAM304       2          320264148
MAM305       3          385458195
MAM306       3          331738258
MAM307       4          389192595
MAM308       4          343432318
MAM309       5          237217393
MAM31        5          285741626
MAM310       1          285828854
MAM311       1          283024685
MAM312       1          272118962
MAM313       2          321584478
MAM314       3          338938976
MAM315       4          356492296
MAM316       5          350815716
MAM317       4          235575269
MAM318       4          286784425
MAM319       3          352570918
MAM32        5          342804543
MAM320       4          382692330
MAM321       5          314285930
MAM322       4          355174350
MAM323       6          373599730
MAM324       8          307740706
MAM325       1          127492700
MAM326       1          277742375
MAM327       2          275763996
MAM328       3          356884658
MAM329       3          327535230
MAM33        8          370485433
MAM330       4          374210751
MAM331       3          245385509
MAM332       5          340631299
MAM333       7          366764522
MAM334       12         362960749
MAM335       3          333986335
MAM336       4          379227081
MAM337       1          86234462
MAM338       5          346249165
MAM339       5          391590872
MAM34        6          316655225
MAM340       7          353830373
MAM341       5          274535835
MAM342       2          309838295
MAM343       2          233798732
MAM344       4          389932720
MAM345       5          321277221
MAM346       4          370617065
MAM347       6          378690181
MAM348       8          318905079
MAM349       9950       141323546
MAM35        4          238884849
MAM36        4          355768297
MAM37        6          355037276
MAM38        7          389945117
MAM39        6          319172640
MAM4         2          376685399
MAM40        5          323047396
MAM41        4          347221982
MAM42        5          288444151
MAM43        5          375232988
MAM44        5          248962388
MAM45        1          277956744
MAM46        1          154038104
MAM47        3          374028897
MAM48        2          298256496
MAM49        3          355148320
MAM5         2          295769989
MAM50        3          355658200
MAM51        3          369352591
MAM52        7          388919640
MAM53        1          59476289
MAM54        9          26809642
MAM55        54         7614329
MAM56        215        34073042
MAM57        431        71272130
MAM58        861        68509101
MAM59        1706       2411269
MAM6         2          385026516
MAM60        6879       6176592
MAM61        110526     193403794
MAM62        33191      281608286
MAM63        4          358286156
MAM64        5          387739617
MAM65        5          335893012
MAM66        6          364021592
MAM67        6          304412506
MAM68        10         386743576
MAM69        132487     153927560
MAM7         3          316699161
MAM70        117910     169420560
MAM71        8968       8089116
MAM72        1          716413629
MAM73        1          662751787
MAM74        1          611347268
MAM75        1          464895054
MAM76        1          288121652
MAM77        3          338107697
MAM78        1          223449203
MAM79        1          210645437
MAM8         5          343489620
MAM80        1          201318998
MAM81        1          197708286
MAM82        2          320231256
MAM83        2          293750401
MAM84        3          367535284
MAM85        4          351244600
MAM86        367        269065793
MAM87        1          203623556
MAM88        2          383513587
MAM89        4          383666147
MAM9         933        216317382
MAM90        5          381503248
MAM91        263        390074346
MAM92        2          265153725
MAM93        4          366992153
MAM94        5          369689861
MAM95        5          392803577
MAM96        6          298207437
MAM97        3          363734450
MAM98        1          118519168
MAM99        3          328935722
PAT1         420060     157354283
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185286     167791554
PAT109       193743     145685458
PAT11        236000     217102698
PAT110       99369      56253543
PAT111       244010     110313663
PAT112       143101     226372350
PAT113       78462      27199293
PAT114       88269      271848145
PAT115       224845     124890789
PAT116       225593     104788872
PAT117       1441       4528610
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83481      75660869
PAT120       94886      123403652
PAT121       98574      119749391
PAT122       81936      115812708
PAT123       202974     107720499
PAT124       26278      9055986
PAT125       203753     100524714
PAT126       183494     80758738
PAT127       117402     19496593
PAT128       249513     208801622
PAT129       384327     114594921
PAT13        242994     211781414
PAT130       54389      7593250
PAT131       283234     179644992
PAT132       123902     298028332
PAT133       110603     304050297
PAT134       393153     122355956
PAT135       289901     158315098
PAT136       13447      9055574
PAT137       287137     182628882
PAT138       409364     14056923
PAT139       496790     33315054
PAT14        328191     148438413
PAT140       525210     7878150
PAT141       153480     3896903
PAT142       377383     123749333
PAT143       245739     106353938
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140524     153724833
PAT149       6434       91722304
PAT15        63815      1595375
PAT150       177885     181303248
PAT151       71547      185116657
PAT152       75797      115786173
PAT153       75754      115775578
PAT154       46230      38674753
PAT155       245081     68541184
PAT156       202132     63183317
PAT157       264556     57807313
PAT158       309554     83973842
PAT159       458771     54678346
PAT16        197466     165309196
PAT160       227775     118065838
PAT161       359502     132218826
PAT162       288077     50680665
PAT163       154912     4648065
PAT164       228338     77240168
PAT165       228223     72940407
PAT166       281345     18592144
PAT167       65063      7149854
PAT168       153380     170208828
PAT169       73414      134988828
PAT17        217861     141775047
PAT170       74138      123431971
PAT171       137210     84284016
PAT172       175218     2628270
PAT173       233539     99258025
PAT174       198423     145045421
PAT175       229757     110454443
PAT176       105679     68107471
PAT177       80124      122466507
PAT178       260801     46028845
PAT179       294811     4422165
PAT18        217807     104611362
PAT180       7898       118470
PAT181       278538     10765362
PAT182       99587      135915370
PAT183       220908     105875885
PAT184       23922      35278744
PAT185       143999     206566501
PAT186       173285     186742155
PAT187       70129      243259642
PAT188       6542       8869371
PAT189       137168     133366031
PAT19        238917     105580979
PAT190       136588     204923041
PAT191       208570     98960207
PAT192       284101     31395281
PAT193       26294      42269676
PAT194       264589     66935450
PAT195       227269     82111943
PAT196       179588     5746816
PAT197       194345     81150973
PAT198       52348      9088648
PAT199       82690      146051882
PAT2         329678     203029667
PAT20        217484     131790664
PAT200       75930      116106222
PAT201       76058      115438165
PAT202       205771     85563217
PAT203       2801       56020
PAT204       342231     6844620
PAT205       341891     7168782
PAT206       341071     7503562
PAT207       331154     110021550
PAT208       268658     230373189
PAT209       282624     222310160
PAT21        295531     53374496
PAT210       192664     139614235
PAT211       276098     235021090
PAT212       188385     291326630
PAT213       137484     196232251
PAT214       247191     246690030
PAT215       11728      387687504
PAT216       313354     152356909
PAT217       244602     252477336
PAT218       160029     300870611
PAT219       215545     135077252
PAT22        146946     94872615
PAT220       172971     290885692
PAT221       266020     215702006
PAT222       351330     145811389
PAT223       304088     76036760
PAT224       317818     206630332
PAT225       43590      365712261
PAT226       151381     180550783
PAT227       338212     193787787
PAT228       332520     206353769
PAT229       155792     199233054
PAT23        196051     155681695
PAT230       249094     251157045
PAT231       209852     277995521
PAT232       184404     195925874
PAT233       326554     210405939
PAT234       203551     272092254
PAT235       99377      335866542
PAT236       108195     332037529
PAT237       262379     184432748
PAT238       10553      3893045
PAT239       223882     118359990
PAT24        279811     73243514
PAT240       272867     62593613
PAT241       204516     140753584
PAT242       283956     19296326
PAT243       274474     22246020
PAT244       281624     22162860
PAT245       286516     14626296
PAT246       287152     13483600
PAT247       96569      20012641
PAT248       263509     44902329
PAT249       293106     5569014
PAT25        228196     146710879
PAT250       337156     75444653
PAT251       207126     270199202
PAT252       330273     192780592
PAT253       253593     160160166
PAT254       145599     308869479
PAT255       133194     316274917
PAT256       287030     181324411
PAT257       278625     235758296
PAT258       444293     137538220
PAT259       56775      54041209
PAT26        208817     140778194
PAT260       353261     181172286
PAT261       365898     138658815
PAT262       95872      1821568
PAT263       256574     81412641
PAT264       243865     100043489
PAT265       212772     64503605
PAT266       207906     131282090
PAT267       210157     114857497
PAT268       310072     217434276
PAT269       81363      153171502
PAT27        63078      54091824
PAT28        304662     206975876
PAT29        321045     202870000
PAT3         50199      20266137
PAT30        69609      127456994
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255489     168747958
PAT34        232019     138092864
PAT35        62927      29393602
PAT36        159604     193117909
PAT37        187245     152012324
PAT38        211992     134514047
PAT39        97888      9820583
PAT4         329459     180384211
PAT40        349663     21561780
PAT41        269136     102155510
PAT42        166        390395449
PAT43        7284       386170254
PAT44        91554      5256927
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188127     183518372
PAT48        31168      33403072
PAT49        100015     274294276
PAT5         261751     200081584
PAT50        347902     22047460
PAT51        356635     6776065
PAT52        92449      1756531
PAT53        351467     15875870
PAT54        360979     6858601
PAT55        133572     2537868
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217875     164406081
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481490     50382866
PAT63        225648     89298259
PAT64        254276     194530926
PAT65        328258     204073801
PAT66        172120     140793304
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247415     122521643
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224236     103100293
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481148     57356648
PAT84        327470     49354827
PAT85        456810     82498320
PAT86        157644     116021307
PAT87        166938     185706898
PAT88        314966     151662901
PAT89        225065     179111834
PAT9         153367     78064676
PAT90        161503     40776365
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509421     32468072
PAT94        211222     45802544
PAT95        257666     203185753
PAT96        387961     140929435
PAT97        39821      44654582
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8932       217072470
PHG2         4732       226378616
PHG3         5295       215573904
PHG4         4752       231298811
PHG5         7206       228620565
PHG6         4325       226669850
PHG7         10122      151330556
PLN1         135591     171504469
PLN10        18946      157439113
PLN100       20         316869596
PLN100       1          758906661
PLN100       1          861141126
PLN100       1          642382296
PLN100       1          759893476
PLN100       1          689766370
PLN100       1          531462149
PLN100       1          714517032
PLN100       1          717288350
PLN100       1          586345039
PLN100       1          626266972
PLN101       5          284426683
PLN101       1          738085275
PLN101       1          505809789
PLN101       1          759124079
PLN101       1          751612808
PLN101       1          653055523
PLN101       7          358620060
PLN101       687        177292972
PLN101       1          478410592
PLN101       1          530843944
PLN101       1          529541203
PLN102       8          327303441
PLN102       1          616320322
PLN102       1          560314678
PLN102       1          552570299
PLN102       1          477706438
PLN102       1          464083788
PLN102       1          411577152
PLN102       1          461076154
PLN102       1          463363089
PLN102       1          481348281
PLN102       1          411112127
PLN103       61         76849044
PLN103       1          485809178
PLN103       1          525998845
PLN103       1          469027344
PLN103       1          409103995
PLN103       1          460274876
PLN103       1          476570508
PLN103       1          445971407
PLN103       1          490396672
PLN103       1          426632976
PLN103       1          538887009
PLN104       2          355063454
PLN104       1          574640544
PLN104       1          667652801
PLN104       1          573769737
PLN104       1          579564072
PLN104       1          506557729
PLN104       1          469999753
PLN104       1          516880681
PLN104       1          454437434
PLN104       1          415133431
PLN104       1          489887590
PLN105       1          333667882
PLN105       1          289026301
PLN105       1          490033736
PLN105       1          542991241
PLN105       1          484002173
PLN105       1          527161174
PLN105       1          513237590
PLN105       1          458108957
PLN105       1          448178421
PLN105       1          577845554
PLN105       1          529955746
PLN106       1          302574826
PLN106       1          534821622
PLN106       1          551069265
PLN106       1          588203704
PLN106       1          459891171
PLN106       1          555382095
PLN106       1          455803086
PLN106       1          509477500
PLN106       1          582703961
PLN106       1          567151184
PLN106       1          459232789
PLN107       1          296818136
PLN107       1          577255397
PLN107       1          441736736
PLN107       1          534335728
PLN107       19         2859863
PLN107       1          613662638
PLN107       1          794474755
PLN107       1          760111594
PLN107       1          769810128
PLN107       1          715684684
PLN107       1          623890083
PLN108       1          257455782
PLN108       1          755457679
PLN108       1          717109572
PLN108       1          817712742
PLN108       1          864624966
PLN108       1          701857263
PLN108       1          726425509
PLN108       1          738041677
PLN108       1          767912069
PLN108       1          504659958
PLN108       1          662526948
PLN109       1          252943167
PLN109       1          633282846
PLN109       1          534651777
PLN109       1          584285409
PLN109       1          507261758
PLN109       1          659687352
PLN109       1          224073253
PLN109       1          198628823
PLN109       1          322486422
PLN109       1          260047251
PLN109       1          262402055
PLN11        29376      278343654
PLN110       1          225803546
PLN110       1          330012911
PLN110       1          349800169
PLN110       1          354403191
PLN110       1          317988395
PLN110       1          376468909
PLN110       313        342168471
PLN110       5          315557653
PLN110       18         309282167
PLN110       10         333088290
PLN110       79         344751863
PLN111       1          219123305
PLN111       39         343075450
PLN111       5          325733636
PLN111       389        384262295
PLN111       10         375480087
PLN111       10         379071384
PLN111       9          351388705
PLN111       2          74237962
PLN111       1          472108912
PLN111       1          611709054
PLN111       1          571129681
PLN112       2          394302667
PLN112       1          563957086
PLN112       1          535211053
PLN112       1          496554540
PLN112       1          578502594
PLN112       143        369836079
PLN112       10         389503495
PLN112       10         374804231
PLN112       8          300501703
PLN112       10         369372075
PLN112       1042       169430586
PLN113       55         43040327
PLN113       1          605966608
PLN113       1          703076930
PLN113       1          495911329
PLN113       1          796169439
PLN113       1          779372321
PLN113       1          665561653
PLN113       1          757165295
PLN113       1          852704148
PLN113       1          623698249
PLN113       1          745048881
PLN114       15         305289289
PLN114       1          677947850
PLN114       1          524289323
PLN114       1          726838826
PLN114       1          701430346
PLN114       1          584133940
PLN114       1          622677745
PLN114       1          745712656
PLN114       1          490622797
PLN114       1          748850018
PLN114       1          753856519
PLN115       2          286029496
PLN115       1          643890519
PLN115       699        30235861
PLN115       1          593930347
PLN115       1          702775664
PLN115       1          494594617
PLN115       1          792837209
PLN115       1          812232696
PLN115       1          661835603
PLN115       1          750337041
PLN115       1          854463248
PLN116       2          307738366
PLN116       1          623248023
PLN116       1          749950614
PLN116       1          673746810
PLN116       1          520815567
PLN116       1          712547961
PLN116       1          703299309
PLN116       1          569771178
PLN116       1          620176429
PLN116       1          717542863
PLN116       1          493761083
PLN117       2          269669619
PLN117       1          746502734
PLN117       1          752612656
PLN117       1          648661963
PLN117       572        38290762
PLN117       1          540897063
PLN117       1          449127287
PLN117       1          425675180
PLN117       1          463192880
PLN117       1          485323027
PLN117       1          448461343
PLN118       1          157681923
PLN118       1          493511962
PLN118       1          462796039
PLN118       1          589118817
PLN118       1          638425132
PLN118       1          716105986
PLN118       1          613160974
PLN118       1          626220839
PLN118       1          551718542
PLN118       1          484215583
PLN118       1          532103454
PLN119       40         376080648
PLN119       1          480949782
PLN119       1          455353809
PLN119       1          499214392
PLN119       1          298028472
PLN119       1          528225653
PLN119       237        375880438
PLN119       6          375232671
PLN119       299        384945076
PLN119       9          251431714
PLN119       132        156051013
PLN12        2660       334399488
PLN120       33         389701062
PLN120       1          593930347
PLN120       1          702775664
PLN120       1          494594617
PLN120       1          792837209
PLN120       1          812232696
PLN120       1          661835603
PLN120       1          750337041
PLN120       1          854463248
PLN120       1          623248023
PLN120       1          749950614
PLN121       106        384154506
PLN121       1          673746810
PLN121       1          520815567
PLN121       1          712547961
PLN121       1          703299309
PLN121       1          569771178
PLN121       1          620176429
PLN121       1          717542863
PLN121       1          493761083
PLN121       1          746502734
PLN121       1          752612656
PLN122       55         188199075
PLN122       1          648661963
PLN122       53         362278903
PLN122       6681       233648974
PLN122       1          445829560
PLN122       1          657893865
PLN122       1          636117214
PLN122       1          520569408
PLN122       1          614738994
PLN122       1          536175046
PLN122       1          610578938
PLN123       2          324178388
PLN123       4          16378138
PLN123       58         389996895
PLN123       14         385024567
PLN123       30         368986150
PLN123       14         379761940
PLN123       14         388380456
PLN123       5          138123356
PLN123       14         386817082
PLN123       14         393670454
PLN123       28         388378543
PLN124       3          383186249
PLN124       21         371825237
PLN124       14         382705053
PLN124       5          137783507
PLN124       13         362021382
PLN124       14         384652328
PLN124       14         385328574
PLN124       14         387607699
PLN124       13         362161900
PLN124       7          192427420
PLN124       14         391787584
PLN125       2          268356222
PLN125       14         371741286
PLN125       10         360532952
PLN125       5          370119782
PLN125       8          393655910
PLN125       6          194621872
PLN125       23         318601285
PLN125       4          331833036
PLN125       6          383779503
PLN125       7          364418253
PLN125       6          168945745
PLN126       2          324123174
PLN126       11         364495457
PLN126       13         371343624
PLN126       14         390506009
PLN126       50         388504808
PLN126       129        388429313
PLN126       2          272777406
PLN126       3          366184951
PLN126       4          390049233
PLN126       24         380686187
PLN126       10         347834156
PLN127       3          363018427
PLN127       86         388181498
PLN127       4          325693820
PLN127       2          159399660
PLN127       5          345056615
PLN127       6          348214746
PLN127       7          349249048
PLN127       8          356243003
PLN127       3          198571596
PLN127       3          333480027
PLN127       53         388888259
PLN128       27         379124606
PLN128       222        363108809
PLN128       10         364192173
PLN128       1          291295799
PLN128       1          258385429
PLN128       1          310695138
PLN128       2          390386182
PLN128       1          268171085
PLN128       29         349658376
PLN128       6          349885803
PLN128       7          374035469
PLN129       19         134550855
PLN129       5          384499932
PLN129       3          317526865
PLN129       4          348522543
PLN129       121        392720692
PLN129       11         336203737
PLN129       2          287149637
PLN129       3          359070095
PLN129       10         373903616
PLN129       2          159588847
PLN129       5          371769032
PLN13        37         329935405
PLN130       57         390189770
PLN130       7          383050287
PLN130       9          373845120
PLN130       7          344699691
PLN130       187        262122807
PLN130       1          865431811
PLN130       1          841368522
PLN130       1          772393794
PLN130       1          766078222
PLN130       1          735900830
PLN130       1          693266847
PLN131       11         373036233
PLN131       1          690056233
PLN131       1          654671025
PLN131       1          681539918
PLN131       1          650134427
PLN131       1          643737533
PLN131       1          547487370
PLN131       1          545352555
PLN131       1          528421643
PLN131       1          538505002
PLN131       1          487455108
PLN132       8          357693623
PLN132       1          484156440
PLN132       1          426775217
PLN132       12         887903
PLN132       1          1574527093
PLN132       1          1805244829
PLN132       1          1716769615
PLN132       1          1637815978
PLN132       1          1645877737
PLN132       1          1365994436
PLN132       1          1520236431
PLN133       6          351635285
PLN133       8          34567157
PLN133       12         272825449
PLN133       1          517902124
PLN133       1          660114068
PLN133       1          623862790
PLN133       1          606413785
PLN133       1          599028035
PLN133       1          556887913
PLN133       1          627107635
PLN133       1          521079582
PLN134       12         293471641
PLN134       1          662966845
PLN134       1          626943711
PLN134       1          613583204
PLN134       1          592677528
PLN134       1          559914542
PLN134       1          632223043
PLN134       1          515585745
PLN134       1          656479363
PLN134       1          621609376
PLN134       1          611088072
PLN135       78         341267500
PLN135       1          589092785
PLN135       1          550920492
PLN135       1          633489054
PLN135       1          520725066
PLN135       1          661498744
PLN135       1          626053568
PLN135       1          608346219
PLN135       1          595508549
PLN135       1          556314873
PLN135       1          639402856
PLN136       128        309527386
PLN136       1          523218450
PLN136       1          661546608
PLN136       1          633922074
PLN136       1          612932250
PLN136       1          591516528
PLN136       1          554835331
PLN136       1          627854320
PLN136       1          530821096
PLN136       1          664715623
PLN136       1          631770265
PLN137       130        349102663
PLN137       1          613234972
PLN137       1          604325310
PLN137       1          582152544
PLN137       1          639225849
PLN137       1          519349950
PLN137       1          661621317
PLN137       1          626868012
PLN137       1          607094319
PLN137       1          595570096
PLN137       1          554304012
PLN138       122        254682704
PLN138       1          628899824
PLN138       1          520888013
PLN138       1          656602423
PLN138       1          622110859
PLN138       1          612883152
PLN138       1          589126655
PLN138       1          553403114
PLN138       1          637622183
PLN138       1          516612726
PLN138       1          656789389
PLN139       196        355571810
PLN139       1          625372561
PLN139       1          603451504
PLN139       1          589471550
PLN139       1          570259662
PLN139       1          634559682
PLN139       1          515709737
PLN139       1          657552530
PLN139       1          618447767
PLN139       1          613586716
PLN139       1          588664924
PLN14        46         124218893
PLN140       129        347273899
PLN140       1          555269530
PLN140       1          631620540
PLN140       1          521019562
PLN140       1          676241010
PLN140       1          632313166
PLN140       1          603807353
PLN140       1          592802360
PLN140       1          562524142
PLN140       1          627446003
PLN140       1          522966862
PLN141       99         327554070
PLN141       1          662000247
PLN141       1          633487160
PLN141       1          612164168
PLN141       1          594048367
PLN141       1          565074362
PLN141       1          631906770
PLN141       1          518331640
PLN141       1          660449817
PLN141       1          627269420
PLN141       1          602651360
PLN142       48         365833376
PLN142       1          589155630
PLN142       1          573351265
PLN142       1          625521901
PLN142       1          532974690
PLN142       1          664401522
PLN142       1          626503588
PLN142       1          611188438
PLN142       1          608423795
PLN142       1          562807231
PLN142       1          639824632
PLN143       60         352557038
PLN143       1          516520956
PLN143       1          657436430
PLN143       1          621715108
PLN143       1          610707416
PLN143       1          589489225
PLN143       1          558356414
PLN143       1          630762742
PLN143       1          520960447
PLN143       1          660500976
PLN143       1          634743673
PLN144       204        383855350
PLN144       1          616002081
PLN144       1          587037840
PLN144       1          563131288
PLN144       1          634603047
PLN144       1          518887001
PLN144       1          669356984
PLN144       1          631173187
PLN144       1          607766370
PLN144       1          585483089
PLN144       1          560323074
PLN145       137        390468270
PLN145       1          625985199
PLN145       1          517292502
PLN145       1          664077638
PLN145       1          624178744
PLN145       1          609451706
PLN145       1          590447534
PLN145       1          554191557
PLN145       1          631526965
PLN145       1          660034972
PLN145       1          625104971
PLN146       87         392025534
PLN146       1          608830648
PLN146       1          593636266
PLN146       1          553161090
PLN146       1          627960241
PLN146       1          519024526
PLN146       1          526310788
PLN146       1          664689228
PLN146       1          632403820
PLN146       1          613638454
PLN146       1          591698735
PLN147       112        383031127
PLN147       1          581262030
PLN147       1          626115335
PLN147       1          520902061
PLN147       1          660476038
PLN147       1          624334204
PLN147       1          613769411
PLN147       1          589927450
PLN147       1          557572468
PLN147       1          631025561
PLN147       1          517464799
PLN148       17         61341131
PLN148       1          663019822
PLN148       1          626669531
PLN148       1          612901747
PLN148       1          584301642
PLN148       1          565756020
PLN148       1          622534699
PLN148       1          535262788
PLN148       1          667210568
PLN148       1          635382001
PLN148       1          614569426
PLN149       69         334048427
PLN149       1          596886610
PLN149       1          572305800
PLN149       1          640929948
PLN149       1          522786484
PLN149       1          626973123
PLN149       1          611284754
PLN149       1          595906842
PLN149       1          554574222
PLN149       1          659290088
PLN149       1          630902477
PLN15        9          366014477
PLN150       15         374915998
PLN150       1          519834778
PLN150       1          660553991
PLN150       1          632999331
PLN150       1          616334843
PLN150       1          595538521
PLN150       1          579057524
PLN150       1          636085299
PLN150       1          523135642
PLN150       1          659217363
PLN150       1          627225202
PLN151       15         376631523
PLN151       1          611858135
PLN151       1          587395717
PLN151       1          576995797
PLN151       1          634448181
PLN151       1          517928713
PLN151       1          660591081
PLN151       1          627080904
PLN151       1          609113147
PLN151       1          586715499
PLN151       1          551946537
PLN152       117        268512615
PLN152       1          628475395
PLN152       1          525655293
PLN152       1          659787933
PLN152       1          626680366
PLN152       1          612118009
PLN152       1          587712295
PLN152       1          559096804
PLN152       1          630943643
PLN152       1          522820138
PLN152       1          662624081
PLN153       100        319711472
PLN153       1          626502968
PLN153       1          614857888
PLN153       1          596061397
PLN153       1          565632896
PLN153       1          633097160
PLN153       1          520045545
PLN153       1          669220190
PLN153       1          629226312
PLN153       1          613110551
PLN153       1          588732137
PLN154       22         387363813
PLN154       1          556172742
PLN154       1          637570351
PLN154       1          522666417
PLN154       1          658438119
PLN154       1          628047470
PLN154       1          612916554
PLN154       1          592600672
PLN154       1          551251939
PLN154       1          629663977
PLN154       1          521099473
PLN155       40         378828844
PLN155       1          657631428
PLN155       1          629616096
PLN155       1          610488678
PLN155       1          591047499
PLN155       1          554657029
PLN155       1          630750677
PLN155       1          517280455
PLN155       1          655385637
PLN155       1          626286153
PLN155       1          610690180
PLN156       7          361494327
PLN156       1          590980959
PLN156       1          550756125
PLN156       1          625691277
PLN156       1          519759058
PLN156       1          659936173
PLN156       1          627661034
PLN156       1          608478632
PLN156       1          598751202
PLN156       1          566136716
PLN156       1          630318266
PLN157       314        319348366
PLN157       1          527482853
PLN157       1          654540277
PLN157       1          624453744
PLN157       1          610565479
PLN157       1          592444850
PLN157       1          561781046
PLN157       1          629203537
PLN157       1          515443273
PLN157       1          661109612
PLN157       1          624188817
PLN158       53         377264056
PLN158       1          609603980
PLN158       1          590388879
PLN158       1          562718084
PLN158       1          625819277
PLN158       1          523454866
PLN158       1          657668641
PLN158       1          627263816
PLN158       1          611107145
PLN158       1          589117401
PLN158       1          554771185
PLN159       112        343386395
PLN159       1          633842266
PLN159       1          517633270
PLN159       1          659552134
PLN159       1          627284235
PLN159       1          612025601
PLN159       1          588480121
PLN159       1          559809231
PLN159       1          632533261
PLN159       1          522933788
PLN159       1          660627594
PLN16        2398       341031318
PLN160       6          326759735
PLN160       1          636764043
PLN160       1          612684114
PLN160       1          586202015
PLN160       1          586202737
PLN160       1          623708439
PLN160       1          520103116
PLN160       1          660087335
PLN160       1          626870575
PLN160       1          607666773
PLN160       1          586243134
PLN161       17         340023864
PLN161       1          573947504
PLN161       1          629731147
PLN161       1          521588016
PLN161       1          663157241
PLN161       1          626857742
PLN161       1          607587567
PLN161       1          590833548
PLN161       1          575584426
PLN161       1          631983138
PLN161       1          517909262
PLN162       115        393450449
PLN162       1          660726353
PLN162       1          625613366
PLN162       1          606853752
PLN162       1          591973374
PLN162       1          553461919
PLN162       1          627871618
PLN162       1          520737098
PLN162       1          659649991
PLN162       1          630477981
PLN162       1          612914000
PLN163       81         370027281
PLN163       1          592900278
PLN163       1          566194267
PLN163       1          634521465
PLN163       1          520869472
PLN163       1          657190419
PLN163       1          626766831
PLN163       1          610506001
PLN163       1          586056641
PLN163       1          553642618
PLN163       1          626388232
PLN164       29         394591747
PLN164       1          525410090
PLN164       1          659109138
PLN164       1          625619081
PLN164       1          605020174
PLN164       1          587821929
PLN164       1          556379494
PLN164       1          627107131
PLN164       1          523665466
PLN164       1          660123737
PLN164       1          626033862
PLN165       85         285066112
PLN165       1          611584699
PLN165       1          586378948
PLN165       1          560255346
PLN165       1          629468067
PLN165       1          561751373
PLN165       1          619785342
PLN165       1          634780758
PLN165       1          613857241
PLN165       1          590994522
PLN165       1          562529131
PLN166       1          137970533
PLN166       1          634372697
PLN166       1          523570906
PLN166       1          655608708
PLN166       1          630476109
PLN166       1          611734907
PLN166       1          585492234
PLN166       1          563342470
PLN166       1          633165930
PLN166       1          519860118
PLN166       1          660958633
PLN167       2          265995834
PLN167       1          628850999
PLN167       1          613418293
PLN167       1          593424848
PLN167       1          555705214
PLN167       1          632869554
PLN167       1          516360598
PLN167       1          662192201
PLN167       1          624651312
PLN167       1          607896916
PLN167       1          589026055
PLN168       3          380342000
PLN168       1          555707176
PLN168       1          627906795
PLN168       1          521007172
PLN168       1          659736604
PLN168       1          626336238
PLN168       1          607408596
PLN168       1          594348488
PLN168       1          555532898
PLN168       1          629181785
PLN168       1          527625328
PLN169       3          341478110
PLN169       1          662539114
PLN169       1          634696490
PLN169       1          614659814
PLN169       1          587540383
PLN169       1          567538777
PLN169       1          630541341
PLN169       1          520277344
PLN169       1          657222892
PLN169       1          629605540
PLN169       1          613053250
PLN17        1949       233857567
PLN170       4          364941990
PLN170       1          589424887
PLN170       1          555169479
PLN170       1          630615884
PLN170       1          522385343
PLN170       1          663034619
PLN170       1          623546353
PLN170       1          613383894
PLN170       1          586397192
PLN170       1          558702188
PLN170       1          631340553
PLN171       2          267241309
PLN171       6          169506233
PLN171       14         377335903
PLN171       14         378243710
PLN171       14         386520074
PLN171       14         381342717
PLN171       13         352824152
PLN171       1          158169978
PLN171       2          351634268
PLN171       1          279860179
PLN171       1          259520967
PLN172       3          377845747
PLN172       2          294703259
PLN172       1          238633233
PLN172       1          162496318
PLN172       1          420743833
PLN172       1          155907
PLN172       1          454733196
PLN172       1          446096000
PLN172       1          431552901
PLN172       1          379526086
PLN172       1          338376119
PLN173       2          218300262
PLN173       1          315777457
PLN173       4          356829234
PLN173       13         321943140
PLN173       1          77851525
PLN173       16         384723689
PLN173       11         328169402
PLN173       1          520479541
PLN173       1          655484837
PLN173       1          626855960
PLN173       1          604911185
PLN174       3          351455647
PLN174       1          592828626
PLN174       1          553427711
PLN174       1          632952271
PLN174       1          519862256
PLN174       1          631897805
PLN174       1          637173558
PLN174       1          641960388
PLN174       1          602818061
PLN174       1          573364513
PLN174       1          633728780
PLN175       3          282049637
PLN175       1          521760062
PLN175       1          660305412
PLN175       1          629753639
PLN175       1          609200707
PLN175       1          603021941
PLN175       1          572539457
PLN175       1          633965700
PLN175       1          521007160
PLN175       1          659208678
PLN175       1          627226266
PLN176       2          296748967
PLN176       1          603942392
PLN176       1          589029421
PLN176       1          556009491
PLN176       1          622798265
PLN176       1          519064071
PLN176       1          661554418
PLN176       1          627699516
PLN176       1          609498991
PLN176       1          588006371
PLN176       1          560132838
PLN177       2          276176029
PLN177       1          630178242
PLN177       47         358995759
PLN177       11         298931337
PLN177       30         62930933
PLN177       1          475425392
PLN177       1          592785984
PLN177       1          369077699
PLN177       1          639092456
PLN177       1          650132723
PLN177       1          502756319
PLN178       2          265406188
PLN178       1          616552515
PLN178       1          734473537
PLN178       1          475660819
PLN178       1          624362023
PLN178       1          589372991
PLN178       1          401580522
PLN178       1          568783180
PLN178       1          587942095
PLN178       1          429272691
PLN178       1          492611322
PLN179       3          366102397
PLN179       1          588888971
PLN179       1          366110095
PLN179       1          602817757
PLN179       1          637984644
PLN179       1          484660871
PLN179       14         393517910
PLN179       13         380754168
PLN179       7          360887511
PLN179       11         370515825
PLN179       7          255465082
PLN18        3          330514248
PLN180       3          310633103
PLN180       10         393847493
PLN180       16         394123581
PLN180       39         387990033
PLN180       40         384498328
PLN180       3          143841883
PLN180       41         297752645
PLN180       1          494422770
PLN180       1          646201372
PLN180       1          587623253
PLN180       1          663525381
PLN181       1          90243615
PLN181       1          626841358
PLN181       1          543353244
PLN181       1          664393216
PLN181       1          20213230
PLN181       1          525133463
PLN181       1          663523538
PLN181       1          635405230
PLN181       1          611936476
PLN181       1          591425152
PLN181       1          558728961
PLN182       2          339450567
PLN182       1          639057917
PLN182       1          522014794
PLN182       1          660736956
PLN182       1          627598042
PLN182       1          612187513
PLN182       1          594408327
PLN182       1          560662121
PLN182       1          627617921
PLN182       1          518127376
PLN182       1          673406957
PLN183       2          383562320
PLN183       1          630137118
PLN183       1          612939186
PLN183       1          591826921
PLN183       1          559508581
PLN183       1          635278407
PLN183       1          520353376
PLN183       1          657661460
PLN183       1          626889213
PLN183       1          610003100
PLN183       1          595851820
PLN184       2          318742289
PLN184       1          552676438
PLN184       1          626222545
PLN184       1          519806694
PLN184       1          662475302
PLN184       1          630354994
PLN184       1          612387238
PLN184       1          588087319
PLN184       1          567667584
PLN184       1          630313422
PLN184       1          518756967
PLN185       2          356433379
PLN185       1          653250953
PLN185       1          631324550
PLN185       1          609093722
PLN185       1          586821064
PLN185       1          562702819
PLN185       1          626718581
PLN185       1          518364809
PLN185       1          655260812
PLN185       1          634191159
PLN185       1          614681618
PLN186       2          302010261
PLN186       1          597998838
PLN186       1          574769137
PLN186       1          626583961
PLN186       1          526252571
PLN186       1          658721539
PLN186       1          626163282
PLN186       1          609194012
PLN186       1          589037043
PLN186       1          564342937
PLN186       1          639123221
PLN187       2          361337975
PLN187       1          523553505
PLN187       1          656359106
PLN187       1          622273932
PLN187       1          610730036
PLN187       1          596985997
PLN187       1          555033258
PLN187       1          629967781
PLN187       1          520365393
PLN187       1          657708949
PLN187       1          625240013
PLN188       41         389463936
PLN188       1          610861510
PLN188       1          581278401
PLN188       1          555013765
PLN188       1          630182139
PLN188       1          522172269
PLN188       1          657289215
PLN188       1          624169276
PLN188       1          611474174
PLN188       1          589543088
PLN188       1          562615538
PLN189       56         346155909
PLN189       1          625823540
PLN189       1          528855042
PLN189       1          664634244
PLN189       1          643202471
PLN189       1          617103718
PLN189       1          604603948
PLN189       1          556510820
PLN189       1          645264326
PLN189       1          518487512
PLN189       1          660262686
PLN19        37         343581774
PLN190       28         344950285
PLN190       1          634680428
PLN190       1          612896067
PLN190       1          590051029
PLN190       1          563934483
PLN190       1          633380624
PLN190       1          525747031
PLN190       1          658111403
PLN190       1          631828453
PLN190       1          612358733
PLN190       1          596986316
PLN191       74         110183622
PLN191       1          575641890
PLN191       1          634497571
PLN191       1          526546151
PLN191       1          661402595
PLN191       1          635870417
PLN191       1          617906818
PLN191       1          592339983
PLN191       1          562165821
PLN191       1          639539621
PLN191       1          522184041
PLN192       46         387316355
PLN192       1          666500271
PLN192       1          632086707
PLN192       1          607961820
PLN192       1          589088731
PLN192       1          584691581
PLN192       1          640065628
PLN192       18         340091012
PLN192       5          346876740
PLN192       9          390980959
PLN192       12         332062075
PLN193       26         388412848
PLN193       1          63050874
PLN193       9          376864900
PLN193       12         372511925
PLN193       9          378086189
PLN193       11         263651859
PLN193       1          199739593
PLN193       2          344461905
PLN193       3          374253733
PLN193       4          381821281
PLN193       4          318572652
PLN194       45         383275027
PLN194       83         393638492
PLN194       2          159167131
PLN194       6          388559936
PLN194       8          340431512
PLN194       15         383095456
PLN194       9          394035375
PLN194       12         352824577
PLN194       10         351790580
PLN194       9          389123571
PLN194       11         385826758
PLN195       3          296654434
PLN195       10         349341323
PLN195       12         386750055
PLN195       8          382846237
PLN195       4          317913936
PLN195       5          382620307
PLN195       5          361453536
PLN195       6          383120782
PLN195       6          325499506
PLN195       3          326992284
PLN195       3          309672594
PLN196       5          362932580
PLN196       2          199284186
PLN196       4          381810661
PLN196       4          368895169
PLN196       4          320171181
PLN196       5          360856103
PLN196       17         55384138
PLN196       11         382432891
PLN196       15         364788400
PLN196       9          365792098
PLN196       10         252904734
PLN197       3          174796239
PLN197       1          312506452
PLN197       1          298985297
PLN197       1          289954511
PLN197       1          267212794
PLN197       1          251527947
PLN197       1          246038259
PLN197       1          224067570
PLN197       2          394230861
PLN197       5          373151993
PLN197       1          88136734
PLN198       1          307467675
PLN198       5          375018439
PLN198       7          323770455
PLN198       4          345416027
PLN198       5          357817205
PLN198       24         297760884
PLN198       1          2143528264
PLN198       1          2138631366
PLN198       1          2132989935
PLN198       1          2142145023
PLN198       1          2142779784
PLN199       1          240644346
PLN199       1          124381055
PLN199       1          2112395848
PLN199       1          2144481838
PLN199       1          2133121580
PLN199       1          2141806609
PLN199       1          1870266305
PLN199       1          2134931027
PLN199       1          2108664250
PLN199       1          2146278775
PLN199       1          2117022170
PLN2         43088      277012490
PLN20        38         174497774
PLN200       1          237923589
PLN200       1          1576301307
PLN200       1          2067099338
PLN200       1          2134690998
PLN200       1          2136662657
PLN200       1          2140543523
PLN200       1          1531582847
PLN200       1          2146571508
PLN200       1          2138192289
PLN200       1          2101175359
PLN200       1          2146227213
PLN201       1          251400564
PLN201       1          621086779
PLN201       1          2138605540
PLN201       1          2083688238
PLN201       1          2144314009
PLN201       1          2139184679
PLN201       1          172723629
PLN201       1          2132146989
PLN201       1          2133919239
PLN201       1          2133305249
PLN201       1          2100933269
PLN202       1          222005600
PLN202       1          143347570
PLN202       1          2134142781
PLN202       1          2145201137
PLN202       1          2137733646
PLN202       1          1914313492
PLN202       1          2145479601
PLN202       1          2114166385
PLN202       2          3701885723
PLN202       1          2141253099
PLN202       1          2119186544
PLN203       2          353275669
PLN203       1          2142175433
PLN203       1          1498831827
PLN203       1          1020192845
PLN203       10         321674204
PLN203       3          372349544
PLN203       6          295982055
PLN203       4          344625596
PLN203       16         346344238
PLN203       16         348075690
PLN203       1          454441500
PLN204       1          180355996
PLN204       1          579809636
PLN204       1          550374318
PLN204       1          490948109
PLN204       1          518445003
PLN204       1          441130372
PLN204       1          551897936
PLN204       1          453240013
PLN204       1          569675999
PLN204       1          567007916
PLN204       1          496544637
PLN205       18         373335959
PLN205       1          522841693
PLN205       1          441744131
PLN205       1          573537543
PLN205       1          136709
PLN205       1          440949504
PLN205       1          581077694
PLN205       1          538841055
PLN205       1          486522400
PLN205       1          495793880
PLN205       1          435262547
PLN206       173        286692338
PLN206       1          535192930
PLN206       1          434100415
PLN206       1          544199803
PLN206       1          519958927
PLN206       1          477159420
PLN206       1          491531377
PLN206       1          429947770
PLN206       1          549923787
PLN206       1          136692
PLN206       1          448723479
PLN207       91         329588214
PLN207       1          594308209
PLN207       1          551310461
PLN207       1          480566411
PLN207       1          514909529
PLN207       1          428171329
PLN207       1          554483852
PLN207       1          446514975
PLN207       1          595495573
PLN207       1          561532561
PLN207       1          478334130
PLN208       7          345877761
PLN208       1          526451923
PLN208       1          430213863
PLN208       1          555327081
PLN208       1          136650
PLN208       1          447395284
PLN208       1          567447976
PLN208       1          561370202
PLN208       1          507274784
PLN208       1          511274163
PLN208       1          437061773
PLN209       7          386032874
PLN209       1          446215483
PLN209       1          433531554
PLN209       1          581715996
PLN209       1          545854294
PLN209       1          487585716
PLN209       1          502853016
PLN209       1          435966324
PLN209       1          439683703
PLN209       1          136703
PLN209       1          445299727
PLN21        9          363687061
PLN210       27         388696142
PLN210       1          546259763
PLN210       1          492972200
PLN210       1          449037107
PLN210       1          491835565
PLN210       1          414293664
PLN210       1          509203637
PLN210       1          427060722
PLN210       1          517747186
PLN210       1          411139572
PLN210       1          463043347
PLN211       2          278500643
PLN211       1          472050116
PLN211       1          404594180
PLN211       1          525771240
PLN211       1          434184414
PLN211       1          556619333
PLN211       1          449827353
PLN211       1          435193785
PLN211       1          487657026
PLN211       1          420799321
PLN211       1          506847538
PLN212       1          146154786
PLN212       1          424111539
PLN212       1          529336321
PLN212       1          512598572
PLN212       1          464949005
PLN212       1          478050655
PLN212       1          405189081
PLN212       1          503245410
PLN212       1          136621
PLN212       1          433027506
PLN212       1          561888103
PLN213       2          291596214
PLN213       1          543643859
PLN213       1          465101524
PLN213       1          479577933
PLN213       1          370652462
PLN213       1          470832587
PLN213       1          444863034
PLN213       1          549613361
PLN213       1          475614129
PLN213       1          378582797
PLN213       1          484181993
PLN214       2          284209818
PLN214       1          428463662
PLN214       1          456054156
PLN214       1          406795410
PLN214       1          551691529
PLN214       1          469885103
PLN214       1          412545700
PLN214       1          437461740
PLN214       1          367632597
PLN214       1          503019622
PLN214       1          409096790
PLN215       3          380361118
PLN215       1          553356059
PLN215       1          527086346
PLN215       1          439832876
PLN215       1          463419122
PLN215       1          412842520
PLN215       1          433607908
PLN215       1          136684
PLN215       1          438715154
PLN215       1          558432928
PLN215       1          525597199
PLN216       1          146314651
PLN216       1          499105699
PLN216       1          476315696
PLN216       1          404753456
PLN216       1          165207278
PLN216       1          428166829
PLN216       1          531985519
PLN216       1          528375571
PLN216       1          469190473
PLN216       1          499943225
PLN216       1          426883771
PLN217       1          262573928
PLN217       1          518242728
PLN217       1          452485612
PLN217       1          524598351
PLN217       1          551958270
PLN217       1          484316636
PLN217       1          477529720
PLN217       1          418513176
PLN217       1          253507736
PLN217       1          433963092
PLN217       1          546085745
PLN218       1          278118176
PLN218       1          545226034
PLN218       1          468073191
PLN218       1          460900303
PLN218       1          399389643
PLN218       2          147912467
PLN218       1          419675113
PLN218       1          529511041
PLN218       1          505002105
PLN218       1          493534736
PLN218       1          480438381
PLN219       1          249859997
PLN219       1          323037461
PLN219       1          513746860
PLN219       1          436583560
PLN219       1          553766941
PLN219       1          538205655
PLN219       1          496559787
PLN219       1          498664620
PLN219       1          420173649
PLN219       1          553712854
PLN219       1          444660800
PLN22        10         361166576
PLN220       1          281481746
PLN220       1          548162194
PLN220       1          475391106
PLN220       1          422040451
PLN220       1          492582937
PLN220       1          315874374
PLN220       1          520872272
PLN220       1          432790581
PLN220       1          561166410
PLN220       1          497612547
PLN220       1          454958861
PLN221       1          187643412
PLN221       1          475241834
PLN221       1          398551120
PLN221       1          496364735
PLN221       1          136702
PLN221       1          445660949
PLN221       1          488646431
PLN221       1          501478063
PLN221       1          418342823
PLN221       1          491021198
PLN221       1          413178521
PLN222       1          272110166
PLN222       1          469438496
PLN222       1          410203331
PLN222       1          486823465
PLN222       1          532902629
PLN222       1          470057954
PLN222       1          477986613
PLN222       1          395248899
PLN222       1          540739613
PLN222       1          436072789
PLN222       1          565481604
PLN223       1          256679836
PLN223       1          530643946
PLN223       1          474248680
PLN223       1          489943422
PLN223       1          380851109
PLN223       1          488893700
PLN223       1          397601223
PLN223       1          542784013
PLN223       1          546813442
PLN223       1          410174162
PLN223       1          481229106
PLN224       1          252477622
PLN224       1          412422822
PLN224       1          503641832
PLN224       1          136682
PLN224       1          642634776
PLN224       1          827770304
PLN224       1          819590567
PLN224       1          657919172
PLN224       1          735222392
PLN224       1          640551262
PLN224       1          792951870
PLN225       1          253096925
PLN225       1          57931760
PLN225       1          641523445
PLN225       1          830702509
PLN225       1          817725293
PLN225       1          657518596
PLN225       1          728079018
PLN225       1          637620844
PLN225       1          792621069
PLN225       1          48899630
PLN225       1          424301551
PLN226       1          292374568
PLN226       1          363314422
PLN226       1          547589534
PLN226       1          457898396
PLN226       1          471623726
PLN226       1          398746676
PLN226       1          519419467
PLN226       1          435505876
PLN226       1          371211504
PLN226       1          505934463
PLN226       1          434488449
PLN227       1          178437200
PLN227       1          481399899
PLN227       1          415263271
PLN227       1          536522644
PLN227       1          437373607
PLN227       1          539223252
PLN227       1          520659461
PLN227       1          460375097
PLN227       1          458164519
PLN227       1          395065095
PLN227       1          530797330
PLN228       19         385138080
PLN228       1          437410857
PLN228       1          553413267
PLN228       1          511954845
PLN228       1          448722544
PLN228       1          479483748
PLN228       1          420024747
PLN228       1          540111372
PLN228       28         390225068
PLN228       6          385962772
PLN228       6          350186990
PLN229       8          385802779
PLN229       11         349705202
PLN229       8          347249232
PLN229       33         386614164
PLN229       18         95282903
PLN229       21         351552576
PLN229       4          384166153
PLN229       4          344265953
PLN229       11         326991722
PLN229       33         361903520
PLN229       4          358580834
PLN23        11         366621684
PLN230       236        371756449
PLN230       11         386226479
PLN230       10         369658764
PLN230       10         368726946
PLN230       5          320294089
PLN230       1          111907482
PLN230       4          375566199
PLN230       41         387391471
PLN230       9          367321953
PLN230       13         366444366
PLN230       18         394655795
PLN231       12         374568910
PLN231       14         383489795
PLN231       26         303745916
PLN231       4          345833962
PLN231       7          390299593
PLN231       25         384889311
PLN231       3          306485407
PLN231       2          189065850
PLN231       4          358881874
PLN231       5          387850373
PLN231       28         383892895
PLN232       7          208424149
PLN232       22         386079901
PLN232       16         375590392
PLN232       16         388553366
PLN232       9          263771989
PLN232       7          393683767
PLN232       9          333578025
PLN232       7          386485134
PLN232       9          368572858
PLN232       10         318630395
PLN232       2          159213959
PLN233       5          294376703
PLN233       5          335851561
PLN233       4          117295204
PLN233       2          3545513960
PLN233       1          1499997841
PLN233       1          1493209057
PLN233       1          1187610474
PLN233       1          943684407
PLN233       1          688362222
PLN233       6          387891258
PLN233       4          332482390
PLN234       5          302707417
PLN234       6          386679750
PLN234       1          44600615
PLN234       26         370453233
PLN234       20         390354097
PLN234       14         362813163
PLN234       5          338125458
PLN234       10         371781707
PLN234       20         393326515
PLN234       15         392260518
PLN234       14         385262693
PLN235       7          303689386
PLN235       17         392108721
PLN235       11         202846913
PLN235       18         361104560
PLN235       12         365240599
PLN235       10         386385344
PLN235       18         322855589
PLN235       1          614431332
PLN235       1          495016746
PLN235       1          767071137
PLN235       1          671256291
PLN236       1          594546470
PLN236       1          670741101
PLN236       1          671191297
PLN236       1          771176557
PLN236       1          643128204
PLN236       1          694350238
PLN236       1          641290954
PLN236       1          585824631
PLN236       1          589079669
PLN236       1          745638687
PLN236       1          692654486
PLN237       1          587543788
PLN237       5          330718620
PLN237       4          299227853
PLN237       17         388136052
PLN237       12         322122200
PLN237       4          324805835
PLN237       7          320111657
PLN237       4          332805262
PLN237       5          384383892
PLN237       5          354028846
PLN237       6          369699941
PLN238       1          587190583
PLN238       21         393215063
PLN238       16         259453723
PLN238       1          314009907
PLN238       1          276062833
PLN238       1          325849051
PLN238       1          243773284
PLN238       1          174422329
PLN238       1          286409356
PLN238       2          294313319
PLN238       1          307615467
PLN239       1          583925327
PLN239       1          281688668
PLN239       1          334621887
PLN239       1          251295635
PLN239       1          177041146
PLN239       1          282264073
PLN239       4          394456916
PLN239       7          294552474
PLN239       38         378009978
PLN239       16         350211631
PLN239       9          350668717
PLN24        158        378806980
PLN240       1          527343613
PLN240       1          255808591
PLN240       1          238725289
PLN240       1          242286659
PLN240       1          217711359
PLN240       1          216482974
PLN240       1          222991778
PLN240       1          191492741
PLN240       1          196860274
PLN240       2          375509859
PLN240       2          360158230
PLN241       1          513337126
PLN241       2          312325071
PLN241       2          386523408
PLN241       1          228357935
PLN241       1          227991009
PLN241       1          217148095
PLN241       1          212042709
PLN241       1          211849564
PLN241       1          226572831
PLN241       1          207533968
PLN241       2          361941678
PLN242       1          453691697
PLN242       2          359610575
PLN242       2          308330841
PLN242       1          156451178
PLN242       1          246005224
PLN242       1          241208020
PLN242       1          228685204
PLN242       1          226440888
PLN242       1          202811886
PLN242       1          212066696
PLN242       1          202875806
PLN243       37         334786838
PLN243       2          388663172
PLN243       2          322368536
PLN243       2          315656612
PLN243       2          281208831
PLN243       1          956684326
PLN243       1          561974515
PLN243       1          718270646
PLN243       1          682093502
PLN243       1          700447244
PLN243       1          683485999
PLN244       8          340070582
PLN244       1          723946829
PLN244       1          751391258
PLN244       1          651249186
PLN244       1          600211227
PLN244       1          575512124
PLN244       1          573054857
PLN244       1          563790525
PLN244       1          521910117
PLN244       35         369135219
PLN244       35         389171560
PLN245       9          390483320
PLN245       6          240325932
PLN245       16         393108004
PLN245       32         368939935
PLN245       23         331705735
PLN245       4          296118519
PLN245       6          380860026
PLN245       6          350208117
PLN245       16636      358389847
PLN245       83375      199312005
PLN246       7          343029522
PLN247       8          390116206
PLN248       15         370780628
PLN249       12         385801156
PLN25        1          337042926
PLN250       25         392653048
PLN251       14         282141355
PLN252       15         349421970
PLN253       9          359340843
PLN254       9          376777002
PLN255       58         376930268
PLN256       15         368724759
PLN257       2          56138460
PLN258       16         390767870
PLN259       23         356914980
PLN26        1          177533547
PLN260       6          394536461
PLN261       6          379300625
PLN262       4          282458791
PLN263       48         381927407
PLN264       16         259608471
PLN265       4          351020507
PLN266       9          394649745
PLN267       3          133976330
PLN268       13         382257900
PLN269       11         361288517
PLN27        1          292038349
PLN270       18         388332312
PLN271       46         337489092
PLN272       6          335533055
PLN273       2          103073804
PLN274       59         331002847
PLN275       43         389108210
PLN276       44         389602100
PLN277       12         35826761
PLN278       1          494422770
PLN279       1          646201372
PLN28        1          253125799
PLN280       1          587623253
PLN281       1          663525381
PLN282       1          626841358
PLN283       1          543353244
PLN284       1          664393216
PLN285       17         391878458
PLN286       37         367085549
PLN287       4          335506921
PLN288       41         353999455
PLN289       14         388729336
PLN29        1          251194792
PLN290       6          363338195
PLN291       5          342832310
PLN292       5          384145100
PLN293       5          343940327
PLN294       31         389356264
PLN295       14         379066498
PLN296       8          219047659
PLN297       14         379049311
PLN298       13         362610461
PLN299       14         381170151
PLN3         3691       380136672
PLN30        1          253267520
PLN300       14         386467556
PLN301       14         386854991
PLN302       10         270029117
PLN303       14         388645158
PLN304       14         374436503
PLN305       14         381134403
PLN306       14         393815785
PLN307       14         394693729
PLN308       8          219270458
PLN309       14         385209295
PLN31        1          267785325
PLN310       14         386765768
PLN311       15         390393298
PLN312       62         363568203
PLN313       9          329435467
PLN314       1          51237036
PLN315       1          338584084
PLN316       1          361675512
PLN317       1          385644068
PLN318       1          439677103
PLN319       1          445134990
PLN32        1          175912755
PLN320       1          446362846
PLN321       1          472276189
PLN322       1          513951721
PLN323       1          528637745
PLN324       7          198246599
PLN325       13         380242521
PLN326       12         248724944
PLN327       1          338461504
PLN328       1          361521394
PLN329       1          385473225
PLN33        1          266007691
PLN330       1          439507296
PLN331       1          444939869
PLN332       1          446172849
PLN333       1          472104924
PLN334       1          513745672
PLN335       1          528418227
PLN336       11         375070239
PLN337       4          321932444
PLN338       4          341653648
PLN339       1          78546334
PLN34        1          244603042
PLN340       5          350183166
PLN341       7          379152752
PLN342       6          283534392
PLN343       4          360934024
PLN344       9          320625087
PLN345       4          344830342
PLN346       45         353910605
PLN347       10         369403290
PLN348       10         372125698
PLN349       10         378404333
PLN35        1          277312646
PLN350       5          198317301
PLN351       10         361822102
PLN352       10         383642544
PLN353       10         377070722
PLN354       8          349624307
PLN355       6          390662733
PLN356       3          325042636
PLN357       5          367911468
PLN358       55         365935374
PLN359       10         378383316
PLN36        118        388802600
PLN360       10         373333687
PLN361       22         381515733
PLN362       96         222356226
PLN363       36         375753221
PLN364       37         319602800
PLN365       15         327238823
PLN366       6          331780152
PLN367       7          275787757
PLN368       10         379997613
PLN369       35         357606881
PLN37        28         377679233
PLN370       11         394131762
PLN371       13         324514045
PLN372       4          246028233
PLN373       3          360351661
PLN374       2          310670494
PLN375       2          291191153
PLN376       2          278207141
PLN377       2          264415078
PLN378       6          366441300
PLN379       3          105607113
PLN38        31         364870370
PLN380       11         378920689
PLN381       78         362822770
PLN382       10         387989492
PLN383       9          348889311
PLN384       10         388298968
PLN385       13         365926394
PLN386       13         374893407
PLN387       13         370043026
PLN388       29         382808953
PLN389       65         306101464
PLN39        5          331403583
PLN390       37         16871
PLN391       149        79314
PLN392       2469       93786416
PLN393       7181       18795412
PLN394       14346      29953091
PLN395       96796      208650157
PLN396       130372     90767575
PLN397       158757     148037020
PLN398       162645     146385234
PLN399       58047      31866791
PLN4         3521       387668889
PLN40        8          355064647
PLN400       181507     123928997
PLN401       49962      254174135
PLN402       41545      288268410
PLN403       72045      110649218
PLN404       98644      85504671
PLN405       49729      72847341
PLN406       25060      110564695
PLN407       13561      89764040
PLN408       1          774434471
PLN409       8305       28494037
PLN41        14549      335956745
PLN410       1861       361385154
PLN411       5          372618381
PLN412       6          372447772
PLN413       6          368295254
PLN414       2          132503639
PLN415       498        311771607
PLN416       8          327823341
PLN417       6          343447962
PLN418       1          66465249
PLN419       1          474651383
PLN42        5168       6202713
PLN420       1          612216829
PLN421       1          571018318
PLN422       1          574020038
PLN423       1          538550714
PLN424       1          514282554
PLN425       1          575541767
PLN426       134        336045988
PLN427       13675      307007082
PLN428       174189     123954464
PLN429       24771      16089538
PLN43        96584      101383193
PLN430       148179     156064469
PLN431       149380     145717812
PLN432       87069      72017983
PLN433       154392     132576506
PLN434       163866     118476937
PLN435       25401      27610534
PLN436       148070     133561222
PLN437       126453     157684206
PLN438       167369     121298172
PLN439       116304     121244244
PLN44        113437     117621940
PLN440       134918     148962698
PLN441       102480     122621291
PLN442       135558     149992417
PLN443       126494     162954214
PLN444       120498     166540957
PLN445       21374      19345477
PLN446       124166     164073406
PLN447       112843     172580761
PLN448       86183      159282387
PLN449       118846     171990169
PLN45        57311      72144580
PLN450       110646     197005174
PLN451       57806      222596852
PLN452       808        371274420
PLN453       18820      41235315
PLN454       19737      363518883
PLN455       10232      333664247
PLN456       302        288936846
PLN457       5          324373291
PLN458       1670       369972731
PLN459       1620       2256477
PLN46        28689      28922869
PLN460       1384       387002570
PLN461       8          179149947
PLN462       1282       232633870
PLN463       1          522466905
PLN464       1          675310294
PLN465       1          628753756
PLN466       1          624247919
PLN467       1          599018945
PLN468       1          573247234
PLN469       1          634667502
PLN47        2648       194594881
PLN470       8563       149646365
PLN471       1          727344967
PLN472       1          946003158
PLN473       1          965754312
PLN474       1          906459801
PLN475       1          876148008
PLN476       1          885153844
PLN477       1          899925126
PLN478       1          528437893
PLN479       4156       344360411
PLN48        344        254550430
PLN480       10         362580157
PLN481       4          120184706
PLN482       129        363594612
PLN483       404        366581476
PLN484       9          335385998
PLN485       130        308977848
PLN486       206        92200731
PLN487       16         383095167
PLN488       47         120890229
PLN489       1          541700351
PLN49        400        261235914
PLN490       1          696809892
PLN491       1          655542733
PLN492       1          648987779
PLN493       1          622068216
PLN494       1          583456046
PLN495       1          654005093
PLN496       130        298375
PLN497       1          522466905
PLN498       1          675310294
PLN499       1          628753756
PLN5         97871      212329023
PLN50        198        168828441
PLN500       1          624247919
PLN501       1          599018945
PLN502       1          573247234
PLN503       1          634667502
PLN504       344        95023900
PLN505       1          521073757
PLN506       1          672273650
PLN507       1          634137895
PLN508       1          624121443
PLN509       1          607506942
PLN51        298        258873545
PLN510       1          564293627
PLN511       1          632401812
PLN512       1          520603772
PLN513       1          661076038
PLN514       1          626572591
PLN515       1          612852138
PLN516       1          598896166
PLN517       1          570629545
PLN518       1          623813090
PLN519       1          513014082
PLN52        339        265493888
PLN520       1          653624577
PLN521       1          616219606
PLN522       1          610044819
PLN523       1          583417444
PLN524       1          550735148
PLN525       1          620104558
PLN526       1          536602846
PLN527       1          685423969
PLN528       1          640667275
PLN529       1          639123876
PLN53        485        350911896
PLN530       1          612949391
PLN531       1          577192767
PLN532       1          641629864
PLN533       1          500012378
PLN534       1          648922534
PLN535       1          604770208
PLN536       1          597403059
PLN537       1          576456374
PLN538       1          556080982
PLN539       1          603311816
PLN54        112        80604200
PLN540       1          512023576
PLN541       1          652551272
PLN542       1          615767531
PLN543       1          605571303
PLN544       1          592249714
PLN545       1          549757368
PLN546       1          616509610
PLN547       2          1184
PLN548       1          550024188
PLN549       1          710194481
PLN55        455        379563194
PLN550       1          661081403
PLN551       1          659460550
PLN552       1          630572514
PLN553       1          598618390
PLN554       1          658974642
PLN555       1          559656399
PLN556       1          717517502
PLN557       1          672450454
PLN558       1          665297378
PLN559       1          636785599
PLN56        143        364543151
PLN560       1          599706080
PLN561       1          675658265
PLN562       1          523168208
PLN563       1          671211297
PLN564       1          630677708
PLN565       1          623428415
PLN566       1          604298040
PLN567       1          558526623
PLN568       1          628419988
PLN569       1          495661851
PLN57        92         268011045
PLN570       1          640830439
PLN571       1          597781253
PLN572       1          600363860
PLN573       1          570178053
PLN574       1          534998810
PLN575       1          616598997
PLN576       1          537457279
PLN577       1          685947972
PLN578       1          649921694
PLN579       1          641099225
PLN58        108        325736871
PLN580       1          611845738
PLN581       1          581041262
PLN582       1          655783664
PLN583       1          521174834
PLN584       1          667717957
PLN585       1          631819663
PLN586       1          624692602
PLN587       1          597351075
PLN588       1          561737938
PLN589       1          629651422
PLN59        17         390428741
PLN590       1          524514255
PLN591       1          670202054
PLN592       1          631946783
PLN593       1          626743494
PLN594       1          600801835
PLN595       1          566971015
PLN596       1          629827058
PLN597       1          522114480
PLN598       1          671530377
PLN599       1          631910401
PLN6         111630     128054636
PLN60        246        346776993
PLN600       1          622474059
PLN601       1          598240357
PLN602       1          562137082
PLN603       1          633805855
PLN604       1          525723083
PLN605       1          684336246
PLN606       1          636053469
PLN607       1          629969872
PLN608       1          604087610
PLN609       1          568600391
PLN61        155        383508558
PLN610       1          640498578
PLN611       1          519546829
PLN612       1          665715246
PLN613       1          624683667
PLN614       1          621078253
PLN615       1          600910593
PLN616       1          558953701
PLN617       1          626840912
PLN618       1          543344542
PLN619       1          697540743
PLN62        85         329381794
PLN620       1          655862368
PLN621       1          646765634
PLN622       1          618540729
PLN623       1          587963859
PLN624       1          658085510
PLN625       449        378687213
PLN626       15         312691008
PLN627       20         111531882
PLN628       1          596211899
PLN629       1          705338699
PLN63        15         388403916
PLN630       1          493450010
PLN631       1          804285258
PLN632       1          810734643
PLN633       1          673981989
PLN634       1          754496630
PLN635       1          855759449
PLN636       1          614042580
PLN637       1          743847818
PLN638       1          673340788
PLN639       1          515668560
PLN64        22         360710420
PLN640       1          713320806
PLN641       1          703598484
PLN642       1          570159854
PLN643       1          625793224
PLN644       1          721110502
PLN645       1          459355444
PLN646       1          745201001
PLN647       1          749284433
PLN648       1          643344672
PLN649       1          595297365
PLN65        6          376299569
PLN650       1          688905267
PLN651       1          491807393
PLN652       1          769338634
PLN653       1          671568023
PLN654       1          635285330
PLN655       1          745618965
PLN656       1          839470345
PLN657       1          646400022
PLN658       1          747589525
PLN659       1          665179885
PLN66        1          65870126
PLN660       1          506585010
PLN661       1          703962928
PLN662       1          702438406
PLN663       1          568126671
PLN664       1          610851963
PLN665       1          707596419
PLN666       1          465558328
PLN667       1          734536914
PLN668       1          738743901
PLN669       1          636778132
PLN67        93         388494695
PLN670       1          602900890
PLN671       1          697493198
PLN672       1          490518203
PLN673       1          784661008
PLN674       1          810500911
PLN675       1          655314739
PLN676       1          752710991
PLN677       1          890847171
PLN678       1          621781073
PLN679       1          743084022
PLN68        15         373888800
PLN680       1          676741658
PLN681       1          509452426
PLN682       1          710124532
PLN683       1          480767623
PLN684       1          578021311
PLN685       1          620140791
PLN686       1          716573881
PLN687       1          476726550
PLN688       1          756324664
PLN689       1          977471539
PLN69        9          363551984
PLN690       1          642207261
PLN691       1          502612092
PLN692       1          646234737
PLN693       1          605172934
PLN694       1          593744788
PLN695       1          571972453
PLN696       1          545472572
PLN697       1          607667504
PLN698       1          590561804
PLN699       1          685720839
PLN7         64213      184495944
PLN70        60         374148929
PLN700       1          490910922
PLN701       1          782694893
PLN702       1          796420183
PLN703       1          650274702
PLN704       1          739889549
PLN705       1          848590828
PLN706       1          610626473
PLN707       1          738023571
PLN708       1          667607564
PLN709       1          506274898
PLN71        14         212654302
PLN710       1          701434008
PLN711       1          690770133
PLN712       1          567265955
PLN713       1          612987783
PLN714       1          704156067
PLN715       1          475327881
PLN716       1          732118298
PLN717       1          733931846
PLN718       1          636796232
PLN719       1          599764323
PLN72        74         124609184
PLN720       1          691313424
PLN721       1          493357854
PLN722       1          782685093
PLN723       1          786410271
PLN724       1          648139033
PLN725       1          744407562
PLN726       1          835583350
PLN727       1          623221719
PLN728       1          741299132
PLN729       1          669032550
PLN73        8          358353307
PLN730       1          517040482
PLN731       1          711661679
PLN732       1          708205786
PLN733       1          573398137
PLN734       1          583494258
PLN735       1          707105489
PLN736       1          471251328
PLN737       1          737453356
PLN738       1          736349413
PLN739       1          639162162
PLN74        3          347496433
PLN740       1          586755746
PLN741       1          704478343
PLN742       1          492109999
PLN743       1          791475352
PLN744       1          785940626
PLN745       1          661246824
PLN746       1          756990402
PLN747       1          858776195
PLN748       1          621195942
PLN749       1          754256086
PLN75        4          370651368
PLN750       1          670301833
PLN751       1          509263899
PLN752       1          708234589
PLN753       1          725120110
PLN754       1          575129590
PLN755       1          620883766
PLN756       1          727285804
PLN757       1          479660269
PLN758       1          745978486
PLN759       1          750160716
PLN76        2          271593360
PLN760       1          642428577
PLN761       1          591313643
PLN762       1          705330581
PLN763       1          495656580
PLN764       1          803232604
PLN765       1          790745243
PLN766       1          657494025
PLN767       1          759305888
PLN768       1          856542542
PLN769       1          628321883
PLN77        1          150766190
PLN770       1          754364263
PLN771       1          697113365
PLN772       1          504254270
PLN773       1          715354979
PLN774       1          713929667
PLN775       1          572943128
PLN776       1          626959190
PLN777       1          715714221
PLN778       1          483823121
PLN779       1          742917797
PLN78        2          288204953
PLN780       1          748536659
PLN781       1          643784981
PLN782       1          600654286
PLN783       1          685083685
PLN784       1          486317123
PLN785       1          794150360
PLN786       1          799857935
PLN787       1          655329108
PLN788       1          749763888
PLN789       1          838116175
PLN79        2          286787940
PLN790       1          610468321
PLN791       1          736551279
PLN792       1          666328382
PLN793       1          504826275
PLN794       1          702606209
PLN795       1          467876140
PLN796       1          566465558
PLN797       1          614421429
PLN798       1          698878671
PLN799       1          480431564
PLN8         21754      107220939
PLN80        2          295931502
PLN800       1          735408736
PLN801       1          969998116
PLN802       1          635024734
PLN803       10         3368
PLN804       1          595339094
PLN805       1          698605642
PLN806       1          499102108
PLN807       1          791748890
PLN808       1          797311483
PLN809       1          656817438
PLN81        64         355204210
PLN810       1          753360318
PLN811       1          845838138
PLN812       1          619661694
PLN813       1          752772853
PLN814       1          689709469
PLN815       1          509595892
PLN816       1          712797596
PLN817       1          710493282
PLN818       1          570643040
PLN819       1          619886155
PLN82        8          357495982
PLN820       1          705533140
PLN821       1          484551304
PLN822       1          740148362
PLN823       1          757233630
PLN824       1          642499559
PLN825       1          594006513
PLN826       1          693261537
PLN827       1          492948387
PLN828       1          781462734
PLN829       1          802944975
PLN83        2          99419683
PLN830       1          650275864
PLN831       1          756841830
PLN832       1          850623622
PLN833       1          614136911
PLN834       1          723255126
PLN835       1          669876730
PLN836       1          507533340
PLN837       1          712168462
PLN838       1          712339524
PLN839       1          564869106
PLN84        7          376229618
PLN840       1          619418949
PLN841       1          715454519
PLN842       1          478264344
PLN843       1          734693445
PLN844       1          749685439
PLN845       1          633598967
PLN846       1          782818162
PLN847       1          1022071454
PLN848       1          971920087
PLN849       1          827198496
PLN85        6          342806685
PLN850       1          867619200
PLN851       1          806566123
PLN852       1          1015700474
PLN853       1          742303966
PLN854       1          956173857
PLN855       1          916702776
PLN856       1          874517040
PLN857       1          816294110
PLN858       1          750216944
PLN859       1          862608691
PLN86        6          347730275
PLN860       20         4493
PLN861       175        140763171
PLN862       1          516505932
PLN863       1          665585731
PLN864       1          621516506
PLN865       1          610333535
PLN866       1          588218686
PLN867       1          561794515
PLN868       1          632540561
PLN869       118        87991
PLN87        6          350661716
PLN870       1          313789095
PLN871       1          248068439
PLN872       1          241454477
PLN873       1          251811976
PLN874       1          225452224
PLN875       1          173806927
PLN876       2          370152128
PLN877       168        374290347
PLN878       603        391598667
PLN879       10         362580157
PLN88        43         144640005
PLN880       7          281547701
PLN881       1          314258027
PLN882       1          394306295
PLN883       1          325599754
PLN884       1          288763641
PLN885       1          187311108
PLN886       1          277174932
PLN887       1          235078182
PLN888       15         332895745
PLN889       16436      36185494
PLN89        144        326417895
PLN890       5636       1862075
PLN891       5224       2478918
PLN892       1          563502314
PLN893       833        298337632
PLN894       1194       92707173
PLN895       1          594102056
PLN896       1          689851870
PLN897       1          495453186
PLN898       1          780798557
PLN899       1          801256715
PLN9         35208      291130285
PLN90        7          298887356
PLN900       1          651852609
PLN901       1          750843639
PLN902       1          830829764
PLN903       1          615552423
PLN904       1          744588157
PLN905       1          673617499
PLN906       1          509857067
PLN907       1          709773743
PLN908       1          713149757
PLN909       1          566080677
PLN91        6          332369654
PLN910       1          618079260
PLN911       1          720988478
PLN912       1          473592718
PLN913       1          736706236
PLN914       1          750620385
PLN915       1          638686055
PLN916       1          480980714
PLN917       6684       330577769
PLN918       3760       370633860
PLN919       10098      326491459
PLN92        50         340388796
PLN920       1753       12315783
PLN921       1          585266722
PLN922       1          681112512
PLN923       1          775448786
PLN924       1          790338525
PLN925       1          746673839
PLN926       1          836514780
PLN927       1          736872137
PLN928       1          676292951
PLN929       1          669155517
PLN93        72         344929940
PLN930       1          701372996
PLN931       1          615672275
PLN932       1          698614761
PLN933       1          728031845
PLN934       1          722970987
PLN935       12302      8480478
PLN936       94681      142561266
PLN937       109090     181641064
PLN938       87279      199564020
PLN939       84129      200954349
PLN94        5          245775000
PLN940       96868      192943678
PLN941       103865     188895047
PLN942       102009     189116977
PLN943       15491      37541448
PLN944       88832      206698701
PLN945       83936      206559176
PLN946       73571      223530394
PLN947       45437      143389388
PLN948       68341      231927489
PLN949       70009      218588942
PLN95        202        322775705
PLN950       62974      240203405
PLN951       2845       15946229
PLN952       65293      235301936
PLN953       48558      247902789
PLN954       46176      247748960
PLN955       26973      81557532
PLN956       63570      234641446
PLN957       53703      243438720
PLN958       49848      249206620
PLN959       52150      261769668
PLN96        6          336790634
PLN960       56871      240638114
PLN961       18140      61770163
PLN962       54302      252904792
PLN963       60680      234291415
PLN964       54347      244356414
PLN965       54824      194576642
PLN966       57087      241813713
PLN967       37920      261634113
PLN968       39457      279390503
PLN969       43859      261215907
PLN97        5          336035871
PLN970       8155       42475962
PLN971       55139      255039441
PLN972       84862      208194190
PLN973       59760      247411821
PLN974       31618      144930376
PLN975       50274      251596424
PLN976       68065      227279730
PLN977       55183      245989791
PLN978       3159       373245447
PLN979       5          248779719
PLN98        6          326965702
PLN980       1          528447123
PLN981       1          678170541
PLN982       1          639558213
PLN983       1          629672760
PLN984       1          608467472
PLN985       1          565695744
PLN986       1          634886329
PLN987       1          532083992
PLN988       1          684376481
PLN989       1          642597466
PLN99        5          304407451
PLN990       1          631979072
PLN991       1          607115911
PLN992       1          582960187
PLN993       1          640026769
PLN994       1          608979116
PLN995       1          720972993
PLN996       1          501257520
PLN997       1          804602427
PLN998       1          808121247
PLN999       1          649118519
PRI1         23047      60053106
PRI10        2265       387936439
PRI11        4375       381717987
PRI12        2068       191950792
PRI13        2459       391017609
PRI14        17344      243217043
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23840      319341223
PRI20        2239       172855211
PRI21        1          250749103
PRI22        1          238414537
PRI23        2          387789264
PRI24        2          351926207
PRI25        2          301224727
PRI26        2          270924633
PRI27        3          376243325
PRI28        4          374251276
PRI29        5          290585290
PRI3         2613       370370379
PRI30        42294      314449515
PRI31        19027      23602325
PRI32        53141      193817517
PRI33        4          351860731
PRI34        5          337827736
PRI35        3          297245061
PRI36        3          382019003
PRI37        2          285375381
PRI38        2          306826759
PRI39        2          354172067
PRI4         2409       360399901
PRI40        2          394680893
PRI41        1          242696752
PRI42        1          248387328
PRI43        4          371167820
PRI44        2          290544102
PRI45        2          335697777
PRI46        2          374932259
PRI47        1          201098049
PRI48        3          342821652
PRI49        3          371410816
PRI5         2593       353874487
PRI50        4          353958876
PRI51        2          221992011
PRI52        2          268816427
PRI53        3          329857110
PRI54        2          306891344
PRI55        2          363287609
PRI56        2          393898061
PRI57        3          335616699
PRI58        1          67035426
PRI59        3          394194787
PRI6         2112       282951291
PRI60        4          380502592
PRI61        3          376790148
PRI62        4          383911555
PRI63        4          342693529
PRI64        3          384141413
PRI65        2          278974018
PRI66        2          263254124
PRI67        2          330993517
PRI68        2          383734792
PRI69        2          373687171
PRI7         2729       356953890
PRI70        1          203129947
PRI71        15168      359633645
PRI72        115045     180133353
PRI73        49464      97857466
PRI74        74331      199953923
PRI75        54422      215579299
PRI76        34648      144367010
PRI77        69722      214218592
PRI78        97880      190622378
PRI79        1501       237911116
PRI8         3181       362167571
PRI80        1          190673448
PRI81        9368       358512524
PRI82        48933      210767481
PRI83        61478      143044439
PRI84        50503      254665362
PRI85        59986      242473060
PRI86        56714      294628503
PRI87        323        7289753
PRI9         2423       385530941
ROD1         38463      309689602
ROD10        15053      352243468
ROD100       5          331474410
ROD101       2          318539651
ROD102       3          346986554
ROD103       2          195914539
ROD104       3          320471619
ROD105       2          303502892
ROD106       2          280790320
ROD107       3          392932004
ROD108       4          351698734
ROD109       2          368221265
ROD11        1336       2453179
ROD110       2          303625032
ROD111       2          292706097
ROD112       2          278161066
ROD113       3          373049758
ROD114       3          349653794
ROD115       3          308876130
ROD116       4          238660990
ROD117       2          379622902
ROD118       2          334811729
ROD119       2          307236712
ROD12        22213      347967024
ROD120       2          287806543
ROD121       3          391762678
ROD122       3          360814732
ROD123       3          314134467
ROD124       4          239932575
ROD125       2          373193903
ROD126       1          157584965
ROD127       2          299783671
ROD128       2          295158694
ROD129       3          388896513
ROD13        1002       157743814
ROD130       3          359745676
ROD131       3          334741362
ROD132       5          333237167
ROD133       2          317726462
ROD134       1          118876157
ROD135       3          341713382
ROD136       4          374029993
ROD137       3          389445867
ROD138       2          291998396
ROD139       2          278095263
ROD14        53466      238707702
ROD140       4          390852856
ROD141       2          370533799
ROD142       2          304047488
ROD143       2          292691026
ROD144       2          276929041
ROD145       3          372795034
ROD146       3          347692711
ROD147       3          308420172
ROD148       4          236625227
ROD149       2          370341452
ROD15        21658      310382782
ROD150       2          307760277
ROD151       2          294424009
ROD152       2          281871870
ROD153       3          372472209
ROD154       3          349207861
ROD155       2          214783614
ROD156       5          332654019
ROD157       2          367229262
ROD158       2          304331769
ROD159       2          288798215
ROD16        228306     97098819
ROD160       2          275554257
ROD161       2          251405689
ROD162       3          354090641
ROD163       3          326613543
ROD164       5          331013327
ROD165       2          368057253
ROD166       2          306226071
ROD167       1          147422267
ROD168       2          291393309
ROD169       3          385188841
ROD17        97458      65701988
ROD170       3          355338747
ROD171       3          326750920
ROD172       5          331081197
ROD173       1          196977572
ROD174       2          340285783
ROD175       2          310111918
ROD176       2          296020819
ROD177       2          268302591
ROD178       3          367814812
ROD179       3          354083518
ROD18        40589      251998774
ROD180       4          377434897
ROD181       2          58596888
ROD182       2          316597187
ROD183       3          346141334
ROD184       3          309646819
ROD185       3          235883790
ROD186       2          332395505
ROD187       2          297647048
ROD188       2          282771228
ROD189       4          393253035
ROD19        2          383374219
ROD190       2          311845466
ROD191       3          332317170
ROD192       4          331904146
ROD193       2          328442178
ROD194       2          293393805
ROD195       1          133371210
ROD196       2          271974197
ROD197       2          251802734
ROD198       13         271995219
ROD199       2          270496589
ROD2         1810       346955540
ROD20        2          353017828
ROD200       3          366902997
ROD201       3          316563723
ROD202       2          193388464
ROD203       4          334716799
ROD204       5          351324292
ROD205       7          371849360
ROD206       6          366049425
ROD207       3          376938858
ROD208       3          338808579
ROD209       4          381108299
ROD21        2          317259772
ROD210       4          323564818
ROD211       6          393907859
ROD212       8          351603620
ROD213       8          357587743
ROD214       1          188060799
ROD215       2          341922886
ROD216       2          316883888
ROD217       2          280377800
ROD218       3          347137656
ROD219       3          315189109
ROD22        2          289653994
ROD220       3          271011851
ROD221       5          354922138
ROD222       5          294688320
ROD223       2          387647059
ROD224       2          325165809
ROD225       2          311669100
ROD226       2          279641759
ROD227       3          378019186
ROD228       3          366857421
ROD229       4          391937005
ROD23        1          140975125
ROD230       3          259447828
ROD231       2          338914351
ROD232       1          159396618
ROD233       2          300967943
ROD234       2          278090573
ROD235       3          382029770
ROD236       3          346788880
ROD237       4          341355724
ROD238       3          299539788
ROD239       2          384716882
ROD24        3          385591618
ROD240       2          334812016
ROD241       2          317562325
ROD242       2          297867706
ROD243       3          391596307
ROD244       3          375850127
ROD245       3          319077903
ROD246       1          96079412
ROD247       4          372403099
ROD248       2          339353113
ROD249       2          291476052
ROD25        4          335044383
ROD250       3          361948668
ROD251       3          323820154
ROD252       4          334059592
ROD253       2          135967815
ROD254       6          388732520
ROD255       2          384840810
ROD256       2          325715141
ROD257       2          293400725
ROD258       3          361928079
ROD259       3          312575313
ROD26        5          356599364
ROD260       4          339307352
ROD261       6          387071614
ROD262       3          323777831
ROD263       2          323038558
ROD264       2          290396403
ROD265       3          353192969
ROD266       2          176309395
ROD267       4          317700958
ROD268       5          354035076
ROD269       5          364586500
ROD27        2          394024503
ROD270       2          377919911
ROD271       2          322351463
ROD272       2          275598125
ROD273       3          359387094
ROD274       4          359114848
ROD275       5          381796720
ROD276       5          291605963
ROD277       2          349406529
ROD278       2          332414924
ROD279       1          154951719
ROD28        2          369416674
ROD280       2          276957429
ROD281       3          340415119
ROD282       4          344898844
ROD283       5          391338277
ROD284       5          302617006
ROD285       2          360867642
ROD286       2          323987561
ROD287       2          295177884
ROD288       3          353085942
ROD289       4          349381944
ROD29        2          335852806
ROD290       5          391992857
ROD291       6          346362378
ROD292       2          318921425
ROD293       2          329179204
ROD294       1          153606186
ROD295       3          389462371
ROD296       3          321351180
ROD297       4          331856423
ROD298       6          392378592
ROD299       4          297015981
ROD3         1885       351998373
ROD30        2          300392300
ROD300       2          343527564
ROD301       3          385070196
ROD302       3          320857378
ROD303       4          353697838
ROD304       5          370381281
ROD305       6          372002468
ROD306       6          198546824
ROD307       1          239886027
ROD308       2          370791914
ROD309       2          305296299
ROD31        2          283621167
ROD310       3          391064350
ROD311       3          347656586
ROD312       3          320467346
ROD313       5          376772270
ROD314       7          266426420
ROD315       3          364883269
ROD316       3          327896669
ROD317       4          388546352
ROD318       1          97315161
ROD319       5          392290651
ROD32        3          348161973
ROD320       6          378764355
ROD321       8          385917731
ROD322       3          388132291
ROD323       2          221032399
ROD324       3          325123266
ROD325       4          364878457
ROD326       5          393396691
ROD327       6          385454209
ROD328       8          384738797
ROD329       2          389695544
ROD33        5          386542915
ROD330       4          389252158
ROD331       5          367225846
ROD332       6          358950715
ROD333       7          366763757
ROD334       135        372516827
ROD335       1          200613070
ROD336       2          346645949
ROD337       2          327907555
ROD338       2          291370549
ROD339       3          359406685
ROD34        154        237877425
ROD340       3          316625883
ROD341       4          340925316
ROD342       6          362634820
ROD343       25268      85438509
ROD35        1          193958709
ROD36        2          350925653
ROD37        2          319642044
ROD38        2          276360533
ROD39        3          382322699
ROD4         1944       361078959
ROD40        3          366447402
ROD41        84         375321811
ROD42        2          329179204
ROD43        2          290564596
ROD44        3          362508543
ROD45        3          304367499
ROD46        5          385423505
ROD47        6          342729329
ROD48        3          325864489
ROD49        4          358685719
ROD5         1990       363733749
ROD50        4          302148481
ROD51        5          337904903
ROD52        6          385168143
ROD53        6          347801590
ROD54        6          283624907
ROD55        86515      225801977
ROD56        11390      220046248
ROD57        2          307631349
ROD58        2          273205312
ROD59        2          272523522
ROD6         306        57843793
ROD60        3          367476852
ROD61        3          318205593
ROD62        5          305035074
ROD63        2          318173246
ROD64        2          308990189
ROD65        2          273361793
ROD66        3          387778067
ROD67        3          350884214
ROD68        4          388911322
ROD69        4          237246301
ROD7         1975       368354297
ROD70        2          368078907
ROD71        2          295232279
ROD72        2          276158786
ROD73        3          370764878
ROD74        3          367374895
ROD75        5          389069045
ROD76        100        129934266
ROD77        2          318742393
ROD78        3          344928637
ROD79        4          373808507
ROD8         1990       369693686
ROD80        3          390678500
ROD81        2          278778348
ROD82        2          267696443
ROD83        2          294192228
ROD84        3          240341385
ROD85        2          368562428
ROD86        2          305746062
ROD87        2          295306346
ROD88        2          279190114
ROD89        1          126990816
ROD9         1959       368016559
ROD90        3          364697793
ROD91        3          342498328
ROD92        4          374582747
ROD93        3          249713888
ROD94        2          330770236
ROD95        2          292927924
ROD96        2          286762350
ROD97        3          381058419
ROD98        3          353678059
ROD99        3          326328631
STS1         170409     86845107
STS10        202241     61367008
STS11        167006     59450871
STS2         143555     63324543
STS3         8291       4867412
STS4         108725     63673512
STS5         110380     70041358
STS6         106165     81422843
STS7         122522     86626105
STS8         198951     60928175
STS9         8743       2376203
SYN1         54444      100627167
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        8          392789107
SYN23        99         283919894
SYN24        5268       259690287
SYN25        61160      179548013
SYN26        9183       352928592
SYN27        17230      334487459
SYN28        109337     160831254
SYN29        33276      99733669
SYN3         2          294093621
SYN30        22183      296511032
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233360     79647647
TSA10        168556     151807723
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       156378     149913811
TSA109       183785     102062896
TSA11        157777     129834268
TSA110       46582      106286710
TSA111       136867     166252974
TSA112       166495     124901244
TSA113       97423      237859520
TSA114       99257      234633653
TSA115       12708      5978473
TSA116       134189     172362066
TSA117       127781     180160426
TSA118       129595     177105775
TSA119       121186     168272985
TSA12        97090      81392351
TSA120       161588     123667649
TSA121       122311     187541168
TSA122       147961     145186533
TSA123       94592      61300137
TSA124       136202     168455642
TSA125       159235     124954199
TSA126       156460     125810552
TSA127       123500     121448801
TSA13        143803     166125438
TSA14        181274     128537289
TSA15        66503      19953423
TSA16        206960     109167065
TSA17        187291     103573225
TSA18        49603      65723896
TSA19        154594     149438301
TSA2         222146     88664556
TSA20        216430     100054673
TSA21        205490     102782849
TSA22        23776      14252292
TSA23        157937     126687163
TSA24        173072     148399453
TSA25        214206     84411561
TSA26        107859     75824864
TSA27        170344     70732329
TSA28        221651     89477532
TSA29        29733      20452936
TSA3         74968      22652895
TSA30        203801     105213489
TSA31        180099     145440715
TSA32        69822      31097770
TSA33        187392     125238542
TSA34        147367     170573228
TSA35        162061     143463244
TSA36        151566     162792015
TSA37        167242     151938086
TSA38        140834     133825444
TSA39        170040     156652284
TSA4         197157     115804961
TSA40        69540      96684132
TSA41        171682     122074705
TSA42        189724     128201705
TSA43        179004     130074585
TSA44        75912      43109145
TSA45        179829     148956459
TSA46        157580     110411669
TSA47        134660     95403465
TSA48        183454     131877937
TSA49        208660     102956314
TSA5         214836     133894002
TSA50        80586      111968754
TSA51        191615     109275606
TSA52        179810     117228216
TSA53        113652     119320342
TSA54        155201     136003572
TSA55        161488     91817237
TSA56        130889     143855858
TSA57        137079     81286772
TSA58        155441     162401639
TSA59        162373     156460053
TSA6         19260      21470091
TSA60        193151     120607701
TSA61        58953      96808413
TSA62        173239     118026196
TSA63        151994     161916401
TSA64        61517      124800188
TSA65        201330     152320116
TSA66        185417     143496051
TSA67        162494     121036165
TSA68        181441     137352733
TSA69        171437     97550710
TSA7         193237     53106267
TSA70        41533      39009849
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        153005     102368390
TSA76        156511     143520695
TSA77        40571      33632062
TSA78        176683     138455592
TSA79        161599     158562361
TSA8         156250     122191293
TSA80        11806      9816655
TSA81        185669     115791752
TSA82        143260     147547562
TSA83        177228     144669069
TSA84        158729     177360001
TSA85        18209      12701058
TSA86        168396     128972709
TSA87        156485     150537294
TSA88        194540     124973144
TSA89        32593      22930994
TSA9         101489     69225839
TSA90        195904     138162133
TSA91        113368     113467451
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141033     144555977
TSA97        106053     76615758
TSA98        74413      65471527
TSA99        33768      32853514
UNA1         769        4547944
VRL1         131569     138894771
VRL10        72928      93412453
VRL100       9795       222894634
VRL100       12704      377383509
VRL100       11005      326905059
VRL100       12701      377344883
VRL100       12731      377820619
VRL100       12740      378056851
VRL100       13981      367611615
VRL100       2023       60413061
VRL100       12174      363492409
VRL100       12166      363174877
VRL100       12167      363247246
VRL101       10136      221723406
VRL101       12166      363224933
VRL101       2464       73649255
VRL101       12081      361112133
VRL101       12144      363017548
VRL101       12243      365758146
VRL101       9064       270726767
VRL101       12253      365988387
VRL101       12191      364194554
VRL101       12193      364253756
VRL101       12192      364228103
VRL102       3449       91082311
VRL102       3904       116628647
VRL102       12199      364432918
VRL102       12194      364284949
VRL102       12195      364311625
VRL102       12196      364344136
VRL102       12206      364633281
VRL102       2531       75613725
VRL102       12190      364142810
VRL102       12194      364288192
VRL102       12198      364404453
VRL103       9650       221588341
VRL103       12197      364371943
VRL103       7501       224086702
VRL103       12170      363577169
VRL103       12171      363631709
VRL103       12071      360731545
VRL103       7688       229799096
VRL103       12099      361553960
VRL103       12036      358875297
VRL103       11949      355733738
VRL103       11972      356420071
VRL104       11778      218869079
VRL104       12097      360564261
VRL104       4354       129886834
VRL104       11949      355721224
VRL104       12094      355995729
VRL104       11981      356795341
VRL104       4439       132151081
VRL104       12173      359695926
VRL104       12211      364622123
VRL104       12252      365767417
VRL104       12651      369747947
VRL105       9455       221344361
VRL105       10941      326739433
VRL105       12529      373768611
VRL105       12512      373692115
VRL105       12494      373157930
VRL105       12498      373298889
VRL105       6675       199371337
VRL105       12368      369502588
VRL105       11993      358430988
VRL105       11971      357718699
VRL105       11954      357163824
VRL106       3926       112500422
VRL106       11949      357022292
VRL106       2379       71081792
VRL106       11929      356424413
VRL106       11944      356873064
VRL106       12017      359107647
VRL106       4107       122733379
VRL106       12152      363181376
VRL106       12085      361144370
VRL106       14799      364549667
VRL106       12179      361564551
VRL107       7740       222413091
VRL107       12415      363149841
VRL107       7959       176981963
VRL107       7773       223400067
VRL107       7934       224141563
VRL107       11190      221038789
VRL107       6359       157054649
VRL107       7915       223518166
VRL107       8075       224331166
VRL107       9121       224451456
VRL107       4203       118988184
VRL108       9253       221857005
VRL108       9919       222714717
VRL108       7739       224499882
VRL108       10421      222049549
VRL108       2980       61147173
VRL108       12729      220158320
VRL108       21071      210375945
VRL108       9867       224824706
VRL108       5211       64368534
VRL108       18253      217399877
VRL108       14423      219349366
VRL109       7809       221674567
VRL109       14651      212691442
VRL109       8765       63570859
VRL109       9103       222843865
VRL109       7527       223765790
VRL109       8627       222511631
VRL109       50022      131690819
VRL11        120961     144235782
VRL110       8275       198201474
VRL111       7547       222351449
VRL112       8008       221562610
VRL113       7869       221743555
VRL114       2191       65297472
VRL115       8465       221484293
VRL116       7710       221269212
VRL117       10236      220766080
VRL118       7766       222257182
VRL119       174        5185343
VRL12        43854      307766420
VRL120       7825       219494238
VRL121       7362       217947535
VRL122       8228       221900094
VRL123       3876       115020512
VRL124       7642       221204272
VRL125       7468       222605611
VRL126       8350       222718674
VRL127       7445       219700261
VRL128       158        4680085
VRL129       7990       218389264
VRL13        115980     144609275
VRL130       8956       221307070
VRL131       7510       220577308
VRL132       7362       217947954
VRL133       5507       161821308
VRL134       12345      369032529
VRL135       12370      369697978
VRL136       12372      369939371
VRL137       12364      369688221
VRL138       12362      369613714
VRL139       5694       170227962
VRL14        23230      82109795
VRL140       12371      369781020
VRL141       12373      369792803
VRL142       12375      369826375
VRL143       8053       240653467
VRL144       12388      370186985
VRL145       12383      370039801
VRL146       12371      369530068
VRL147       5929       175935992
VRL148       7438       221720425
VRL149       8140       222155693
VRL15        113804     144617802
VRL150       7765       221293296
VRL151       2946       83655703
VRL152       7942       222816214
VRL153       7470       221831148
VRL154       8023       221748161
VRL155       9140       220633913
VRL156       3899       115600600
VRL157       7575       220443196
VRL158       7401       219629478
VRL159       7406       219532528
VRL16        112032     147827613
VRL160       3637       104745014
VRL161       7431       218929276
VRL162       7906       222150305
VRL163       7706       219545819
VRL164       7640       222818655
VRL165       4272       119373144
VRL166       8010       221376536
VRL167       7446       221334576
VRL168       7356       217836218
VRL169       8076       221009370
VRL17        27186      44775593
VRL170       3657       102101919
VRL171       7436       221704344
VRL172       7410       220394033
VRL173       7571       220559196
VRL174       5270       151251118
VRL175       7594       221660605
VRL176       7478       221621778
VRL177       7587       219155405
VRL178       1998       59113996
VRL179       7585       221735125
VRL18        90437      158855355
VRL180       7825       221774298
VRL181       7427       220819814
VRL182       2346       68509657
VRL183       8076       222756930
VRL184       7940       222724721
VRL185       7838       223110568
VRL186       7628       218210704
VRL187       7357       217798071
VRL188       7620       221860214
VRL189       7628       222849873
VRL19        96099      150066351
VRL190       7935       222614648
VRL191       111        3306166
VRL192       7439       221651602
VRL193       7682       222021648
VRL194       7603       221247265
VRL195       2635       78589590
VRL196       7594       221755119
VRL197       7380       218829625
VRL198       7520       220151146
VRL199       7492       222660467
VRL2         126082     150987682
VRL20        62231      101189790
VRL200       4430       119383423
VRL201       7684       222455370
VRL202       7756       221970237
VRL203       8868       221773053
VRL204       7736       218194664
VRL205       4230       124556162
VRL206       8143       222118020
VRL207       7511       221472177
VRL208       7658       224114337
VRL209       9453       223793297
VRL21        92195      165746519
VRL210       4799       139324692
VRL211       7778       221939633
VRL212       8946       222539688
VRL213       7483       221572525
VRL214       7389       218445357
VRL215       4264       126966021
VRL216       7730       221768471
VRL217       8227       221663692
VRL218       8241       224040126
VRL219       7931       223166239
VRL22        90967      163599188
VRL220       4181       119700551
VRL221       7677       221727657
VRL222       7552       222965042
VRL223       7350       217830294
VRL224       8163       223062940
VRL225       4342       126419141
VRL226       7958       222343966
VRL227       9532       219763888
VRL228       8556       221891762
VRL229       7446       221412869
VRL23        54339      121543406
VRL230       4178       123763074
VRL231       7431       220439583
VRL232       7593       222276558
VRL233       7837       222399555
VRL234       7434       221582922
VRL235       4423       121925836
VRL236       7929       222176848
VRL237       7761       221641221
VRL238       7723       221883481
VRL239       7388       219609882
VRL24        83025      172220824
VRL240       3540       105091412
VRL241       7432       221490436
VRL242       7537       222032585
VRL243       8151       222521755
VRL244       7669       222610990
VRL245       3936       117093658
VRL246       7574       222770999
VRL247       8806       222543505
VRL248       7410       219746483
VRL249       7424       221266771
VRL25        85546      166895551
VRL250       3925       117003284
VRL251       7424       221004936
VRL252       8380       222232357
VRL253       7644       221172283
VRL254       7559       221906285
VRL255       4016       117132872
VRL256       7980       220734403
VRL257       7386       219283530
VRL258       7783       221314684
VRL259       2048       61046862
VRL26        70044      119982540
VRL260       9072       220397573
VRL261       8253       221900950
VRL262       8798       221891752
VRL263       2173       64735180
VRL264       7463       221769723
VRL265       7462       222264480
VRL266       7402       220051865
VRL267       7636       221552696
VRL268       8063       221905076
VRL269       7619       222827814
VRL27        82594      167339145
VRL270       3658       109021120
VRL271       7466       221888492
VRL272       8021       220969558
VRL273       7694       222344146
VRL274       7808       222313633
VRL275       3781       112702688
VRL276       7527       221461366
VRL277       7745       220864075
VRL278       7737       222384070
VRL279       7502       221857431
VRL28        83162      166422124
VRL280       4725       116944828
VRL281       7510       220262506
VRL282       7486       221844509
VRL283       7595       222163951
VRL284       7466       221334941
VRL285       6226       184574828
VRL286       7451       221948430
VRL287       7446       221941433
VRL288       7491       222054544
VRL289       2481       73963232
VRL29        50806      113098957
VRL290       7519       222265703
VRL291       7667       222371933
VRL292       7519       222801965
VRL293       3392       101114242
VRL294       7541       218788614
VRL295       7641       221623371
VRL296       7446       221429004
VRL297       4656       137549576
VRL298       7455       230678110
VRL299       7680       220306131
VRL3         93532      168060424
VRL30        90654      178588276
VRL300       7770       222848711
VRL301       4082       119607224
VRL302       7972       221579339
VRL303       7382       219925223
VRL304       7526       221517245
VRL305       5550       165290465
VRL306       7504       221885756
VRL307       8205       222928193
VRL308       7441       220245299
VRL309       5817       171715446
VRL31        34123      302875051
VRL310       7513       222403973
VRL311       7601       223191798
VRL312       7559       222946757
VRL313       7472       220369275
VRL314       377        11231463
VRL315       7865       220324747
VRL316       7514       220301134
VRL317       7492       222701928
VRL318       4238       120052508
VRL319       13128      228485496
VRL32        77874      184388680
VRL320       7415       219048485
VRL321       8319       221528474
VRL322       3745       111430642
VRL323       7779       222427509
VRL324       7586       221187702
VRL325       7527       220775836
VRL326       2508       73321851
VRL327       7800       221583677
VRL328       8142       221615902
VRL329       8612       221100362
VRL33        60959      147425106
VRL330       8711       220054088
VRL331       1049       31248870
VRL332       7853       220693310
VRL333       7435       219775426
VRL334       7416       220390680
VRL335       7248       203105310
VRL336       20449      210572516
VRL337       7440       220960934
VRL338       8441       219147308
VRL339       7683       220128958
VRL34        67608      181934689
VRL340       34         1013669
VRL341       7340       218437065
VRL342       7517       221971863
VRL343       7531       221073709
VRL344       10947      221157812
VRL345       2216       65973623
VRL346       9184       220799700
VRL347       7828       222148265
VRL348       7400       219474138
VRL349       3082       83056403
VRL35        77880      184815065
VRL350       7485       220684760
VRL351       7660       219868450
VRL352       7626       220669528
VRL353       6828       200274547
VRL354       7578       221737035
VRL355       7529       221550216
VRL356       7383       218633333
VRL357       3423       98618833
VRL358       7596       222361948
VRL359       7675       221563923
VRL36        66619      159461653
VRL360       7399       220313944
VRL361       5495       160014237
VRL362       7820       221568143
VRL363       7525       221084119
VRL364       7419       219871130
VRL365       8190       219578851
VRL366       2304       68629377
VRL367       8928       217968848
VRL368       7999       220769513
VRL369       7460       221243634
VRL37        74528      192221569
VRL370       7385       219162957
VRL371       7732       220641119
VRL372       7482       219844968
VRL373       7878       221136455
VRL374       7565       220521556
VRL375       9909       218782899
VRL376       7844       222143459
VRL377       7468       221413584
VRL378       4938       123750203
VRL379       7658       219781629
VRL38        83875      169583772
VRL380       7551       222101387
VRL381       8042       221512432
VRL382       4539       115826637
VRL383       7595       221636930
VRL384       8229       220498062
VRL385       8477       221313062
VRL386       3562       104684083
VRL387       8068       221144032
VRL388       9371       219994695
VRL389       8349       219962552
VRL39        73101      148527195
VRL390       4589       133546685
VRL391       7619       223791272
VRL392       8855       223159050
VRL393       8018       222816370
VRL394       3673       98908472
VRL395       8975       220382463
VRL396       7626       222741779
VRL397       7751       222543139
VRL398       2684       72400598
VRL399       8469       221665726
VRL4         12053      222457284
VRL40        78305      176710707
VRL400       7529       222867640
VRL401       8068       222921415
VRL402       3511       103625228
VRL403       8724       221586329
VRL404       7540       222593665
VRL405       8394       222166937
VRL406       6942       203100840
VRL407       8249       223295751
VRL408       7888       222961332
VRL409       7674       221779668
VRL41        70465      179207354
VRL410       6811       184476500
VRL411       7873       222439223
VRL412       7882       222344915
VRL413       7541       223579550
VRL414       2852       84712584
VRL415       7573       223520412
VRL416       8879       219519426
VRL417       7706       222082073
VRL418       3919       107635063
VRL419       7832       220656189
VRL42        43948      197406569
VRL420       7895       223377518
VRL421       7613       221172600
VRL422       3279       93639546
VRL423       11932      217456494
VRL424       7657       221038515
VRL425       7730       220705079
VRL426       6937       178542043
VRL427       8707       222109765
VRL428       7558       223852914
VRL429       7728       221143983
VRL43        21244      138869597
VRL430       4727       132388134
VRL431       7820       219976645
VRL432       7519       222458098
VRL433       7384       218780069
VRL434       5849       167601166
VRL435       10549      219333938
VRL436       7710       222351573
VRL437       8921       218464746
VRL438       7817       220526427
VRL439       1887       54218419
VRL44        25055      217763452
VRL440       8131       222993387
VRL441       8250       222795973
VRL442       7670       224466742
VRL443       3171       93752799
VRL444       8381       221312902
VRL445       7525       220205402
VRL446       7625       222512972
VRL447       7938       222521779
VRL448       9663       223384609
VRL449       5989       177512443
VRL45        15136      218683822
VRL450       10206      221711088
VRL451       7531       222839087
VRL452       7457       222234031
VRL453       4548       123559243
VRL454       8028       220609338
VRL455       8183       219945858
VRL456       8657       220640976
VRL457       2487       73935070
VRL458       7743       225062862
VRL459       10157      217494212
VRL46        33788      207520730
VRL460       7700       221647396
VRL461       6261       169645128
VRL462       9489       225067854
VRL463       7792       219926719
VRL464       8438       222670077
VRL465       9679       223991122
VRL466       4569       123035592
VRL467       7877       224461783
VRL468       7760       220225115
VRL469       10775      220173152
VRL47        11365      129036868
VRL470       4115       122105870
VRL471       8301       224632793
VRL472       7536       220511234
VRL473       7902       223697392
VRL474       5336       150637614
VRL475       8047       220491182
VRL476       9236       221194044
VRL477       9041       219045374
VRL478       4631       125048012
VRL479       9787       220236604
VRL48        18951      217642108
VRL480       8019       221725831
VRL481       8693       219189816
VRL482       6434       126399760
VRL483       11930      216616123
VRL484       7433       219824600
VRL485       7821       221847340
VRL486       7394       202787004
VRL487       8045       220685919
VRL488       8045       221263397
VRL489       7908       221232564
VRL49        25259      214632337
VRL490       8466       205691712
VRL491       10204      222165513
VRL492       7696       220866804
VRL493       7567       221354902
VRL494       7729       222439928
VRL495       7762       222854389
VRL496       7605       220206476
VRL497       3582       105422037
VRL498       11967      218775844
VRL499       9914       221523141
VRL5         5487       9189768
VRL50        17134      217891465
VRL500       8280       223517542
VRL501       7420       220428526
VRL502       5150       116588094
VRL503       7521       223085922
VRL504       8362       222420875
VRL505       8105       220203671
VRL506       4162       123822105
VRL507       8027       220700155
VRL508       6799       227673871
VRL509       8721       220722135
VRL51        10659      156831400
VRL510       2556       86026104
VRL511       7933       223239839
VRL512       7906       220992356
VRL513       8472       222621040
VRL514       3763       99748509
VRL515       10173      219553112
VRL516       6649       228067841
VRL517       8175       219907464
VRL518       2798       109974996
VRL519       8015       222580358
VRL52        13629      220381406
VRL520       7819       223134889
VRL521       7979       224556048
VRL522       8210       223213873
VRL523       4939       151483975
VRL524       7557       223200900
VRL525       10374      220210222
VRL526       11137      214728875
VRL527       12704      220172605
VRL528       5859       148133620
VRL529       9451       222300383
VRL53        10376      219234428
VRL530       7723       221872355
VRL531       8625       224479074
VRL532       9653       220696992
VRL533       6749       191114348
VRL534       8511       220364900
VRL535       8546       223217772
VRL536       14699      215656924
VRL537       5326       139093121
VRL538       8465       219879309
VRL539       7355       227807669
VRL54        10147      221033028
VRL540       9557       220870304
VRL541       5838       157093426
VRL542       8433       222895648
VRL543       11390      217673900
VRL544       11383      219775555
VRL545       8433       220986262
VRL546       3418       80462275
VRL547       8328       220963135
VRL548       9788       219226027
VRL549       7876       219571898
VRL55        5727       126349438
VRL550       3387       100902308
VRL551       7932       223179020
VRL552       7677       221964082
VRL553       8533       221171612
VRL554       6021       137608301
VRL555       7723       222528551
VRL556       11446      219456099
VRL557       9925       219037682
VRL558       3539       98090076
VRL559       11639      218239635
VRL56        8939       223188128
VRL560       11377      217117045
VRL561       12923      216952061
VRL562       5386       89517221
VRL563       8140       221683716
VRL564       8105       222305994
VRL565       8484       221809508
VRL566       2708       76631504
VRL567       11329      218180057
VRL568       8454       221663103
VRL569       8276       222663700
VRL57        9713       220570663
VRL570       3171       93990521
VRL571       7601       223860255
VRL572       8287       221192926
VRL573       11624      224043181
VRL574       2232       145519660
VRL575       7682       226013759
VRL576       8443       223516268
VRL577       8666       223889715
VRL578       7655       168917636
VRL579       8855       221436987
VRL58        8662       222022397
VRL580       7801       221314004
VRL581       8374       221962046
VRL582       3131       88333979
VRL583       19536      210541861
VRL584       9479       222303510
VRL585       11783      220821602
VRL586       10192      185020675
VRL587       8718       224237779
VRL588       8320       225286626
VRL589       15580      216871515
VRL59        10142      221362831
VRL590       16530      217043843
VRL591       268        7935422
VRL592       8721       221748863
VRL593       7800       223452579
VRL594       7569       223568855
VRL595       2689       79429670
VRL596       9884       220416664
VRL597       22800      218227429
VRL598       14258      217303018
VRL599       11692      181746884
VRL6         93703      148000355
VRL60        3740       86774371
VRL600       8449       224629934
VRL601       12630      221918933
VRL602       11910      220763037
VRL603       10047      214277710
VRL604       12291      219873331
VRL605       9485       223499217
VRL606       12023      224627273
VRL607       8530       223036538
VRL608       2546       42574538
VRL609       7449       222050186
VRL61        10252      221317455
VRL610       7448       222049612
VRL611       7445       221826711
VRL612       2213       63674476
VRL613       9299       224607514
VRL614       12501      220213076
VRL615       12413      223287366
VRL616       5397       92474063
VRL617       10727      220801619
VRL618       9397       221961153
VRL619       8018       221823151
VRL62        13533      217731827
VRL620       3966       85666302
VRL621       13052      218033584
VRL622       10310      222556695
VRL623       13222      219778350
VRL624       2669       69858415
VRL625       16732      219496891
VRL626       11598      221261768
VRL627       10380      221546131
VRL628       5837       81928736
VRL629       9199       222654205
VRL63        8993       220470436
VRL630       8409       222783239
VRL631       7900       223037080
VRL632       10225      220311800
VRL633       3103       88553922
VRL634       12227      365289108
VRL635       12325      368313892
VRL636       6297       188087927
VRL637       1904       56895892
VRL638       12391      370252025
VRL639       12593      375872798
VRL64        11192      219164729
VRL640       12622      376617188
VRL641       6402       190822693
VRL642       12618      376375108
VRL643       12711      378788647
VRL644       12720      379050405
VRL645       7071       210913275
VRL646       12683      378032374
VRL647       12621      376515872
VRL648       12463      372108084
VRL649       4385       130881012
VRL65        2913       82299962
VRL650       12487      372570636
VRL651       12526      373795899
VRL652       12566      374816528
VRL653       3672       109697863
VRL654       12471      372279880
VRL655       12411      370816826
VRL656       12385      370092114
VRL657       6455       192829868
VRL658       12399      370295335
VRL659       12384      370112732
VRL66        7481       220718827
VRL660       12372      369777172
VRL661       3505       104760027
VRL662       12444      371585092
VRL663       12422      371006390
VRL664       12188      367344437
VRL665       2967       88674279
VRL666       3626       108345075
VRL667       12533      374033673
VRL668       12394      370328985
VRL669       12135      361916853
VRL67        8116       221893665
VRL670       3077       91965120
VRL671       12402      370569546
VRL672       12241      365853241
VRL673       12364      369448773
VRL674       11636      347775069
VRL675       12354      368959500
VRL676       12405      369442689
VRL677       12361      369463608
VRL678       3562       106470947
VRL679       12270      366781694
VRL68        9175       219150853
VRL680       12489      372406490
VRL681       12347      368667305
VRL682       8901       266036794
VRL683       12350      368951698
VRL684       12383      369943743
VRL685       12538      374215279
VRL686       12350      369107637
VRL687       6907       206120230
VRL688       12335      368607449
VRL689       12414      370808444
VRL69        18463      212788176
VRL690       12350      369120146
VRL691       12418      370890906
VRL692       1404       41924092
VRL693       12281      367037689
VRL694       12355      369223656
VRL695       12353      369167640
VRL696       9985       298422907
VRL697       12385      370126990
VRL698       12335      368658957
VRL699       12334      368612870
VRL7         86711      143039034
VRL70        2444       68464306
VRL700       8841       264200894
VRL701       12372      369711446
VRL702       12344      368933144
VRL703       12353      369197678
VRL704       6111       182640523
VRL705       12070      360742551
VRL706       11865      354610114
VRL707       12257      366337685
VRL708       7774       232348838
VRL709       12389      370108432
VRL71        7825       220313598
VRL710       12352      369160805
VRL711       12237      365479875
VRL712       7117       212707893
VRL713       12336      368685684
VRL714       12269      366371284
VRL715       12367      369586431
VRL716       7148       213231773
VRL717       12621      376192384
VRL718       12392      370220839
VRL719       12483      372625354
VRL72        7777       220691622
VRL720       7201       215101258
VRL721       12378      369843501
VRL722       12246      365820026
VRL723       12456      371790520
VRL724       7139       213357797
VRL725       12340      368749870
VRL726       12344      368927014
VRL727       12421      370120372
VRL728       6907       206428316
VRL729       12296      367498256
VRL73        8144       220353623
VRL730       12248      366038633
VRL731       12442      372129165
VRL732       12540      373980303
VRL733       3409       101887034
VRL734       12366      369584171
VRL735       12381      370012499
VRL736       12359      369375604
VRL737       12363      369469223
VRL738       1948       58190281
VRL739       12281      366786435
VRL74        6587       182464490
VRL740       12528      373622973
VRL741       12531      373794912
VRL742       12516      373424280
VRL743       2472       73740642
VRL744       12511      373317579
VRL745       12417      370921926
VRL746       12411      370713753
VRL747       2932       87629297
VRL748       12414      370859460
VRL749       12239      365608522
VRL75        7893       221311927
VRL750       12281      366779971
VRL751       3198       95503906
VRL752       12389      370027978
VRL753       12463      371877239
VRL754       12458      371736014
VRL755       3210       95853682
VRL756       12484      372491339
VRL757       12389      369902373
VRL758       12421      370850328
VRL759       12416      370735519
VRL76        8408       220098191
VRL760       3864       115229529
VRL761       12385      369714210
VRL762       12340      368683545
VRL763       12363      369226423
VRL764       6420       191784589
VRL765       12374      369602677
VRL766       12344      368677922
VRL767       12362      369271877
VRL768       12423      370805020
VRL769       7875       235009520
VRL77        8627       218882918
VRL770       12407      370351983
VRL771       12364      369293567
VRL772       12265      366456082
VRL773       9827       293612294
VRL774       12287      367084198
VRL775       12314      367799365
VRL776       12265      366434093
VRL777       12309      367617260
VRL778       12336      368310951
VRL779       12367      369156641
VRL78        6092       160584138
VRL780       3173       94670275
VRL781       12421      370381742
VRL782       12471      372009482
VRL783       12371      369292216
VRL784       12387      369774056
VRL785       12324      368142839
VRL786       11775      351748607
VRL787       12329      368300282
VRL788       12323      368080815
VRL789       12313      367812242
VRL79        12595      218625028
VRL790       12336      368489238
VRL791       9671       288886614
VRL792       12345      368738853
VRL793       12367      369426509
VRL794       12332      368366126
VRL795       12404      370579163
VRL796       2016       60229555
VRL797       12585      371232953
VRL798       12587      376136404
VRL799       12343      368686875
VRL8         91434      144081888
VRL80        8520       219154612
VRL800       12364      369322786
VRL801       12404      370541532
VRL802       8137       243102804
VRL803       12496      373365842
VRL804       12432      371399948
VRL805       12347      368784251
VRL806       12345      368711538
VRL807       9089       271464899
VRL808       12336      368408718
VRL809       12339      368518437
VRL81        8507       221330859
VRL810       12359      369096817
VRL811       12364      369244387
VRL812       595        17768358
VRL813       12381      369696945
VRL814       12374      369501082
VRL815       12379      369644695
VRL816       12369      369361792
VRL817       559        16693996
VRL818       12369      369334319
VRL819       12319      367883423
VRL82        5225       145495902
VRL820       11977      357823472
VRL821       12189      364090905
VRL822       1157       34548722
VRL823       12410      370392096
VRL824       12353      368814433
VRL825       12368      369260664
VRL826       12369      369253976
VRL827       270        8061056
VRL828       12368      369226825
VRL829       12366      369159314
VRL83        7487       220569357
VRL830       12359      368944008
VRL831       6005       179251803
VRL832       12374      369400888
VRL833       12366      369123428
VRL834       12398      370174224
VRL835       12412      370600813
VRL836       1291       38537124
VRL837       12366      369127168
VRL838       12367      369150031
VRL839       12462      371495742
VRL84        7756       222081357
VRL840       12608      375399077
VRL841       1512       45062470
VRL842       12503      372903703
VRL843       12545      374851085
VRL844       12445      371631592
VRL845       4763       142249867
VRL846       12423      370936414
VRL847       12484      372907724
VRL848       12489      373040331
VRL849       4692       140179365
VRL85        7732       222582337
VRL850       12326      368003805
VRL851       12357      368963039
VRL852       12438      371485547
VRL853       4886       146029693
VRL854       12457      371960700
VRL855       12070      360256200
VRL856       11939      356294173
VRL857       5354       159780884
VRL858       12308      367394797
VRL859       12105      361326031
VRL86        809        19987537
VRL860       11914      355237809
VRL861       5524       163959206
VRL862       12538      371903410
VRL863       12591      375430613
VRL864       12558      374548591
VRL865       4880       144920184
VRL866       12639      376713378
VRL867       12655      376553425
VRL868       12555      374447869
VRL869       4942       147491721
VRL87        8446       221799654
VRL870       12541      374002589
VRL871       12655      376277562
VRL872       12646      376463564
VRL873       12651      376010820
VRL874       12587      375090299
VRL875       5286       157447544
VRL876       12554      373766796
VRL877       12634      376058990
VRL878       12672      376416507
VRL879       9395       280019540
VRL88        7794       221823639
VRL880       12589      375044030
VRL881       12627      376412349
VRL882       12616      375952502
VRL883       2976       88570591
VRL884       12667      377031073
VRL885       12460      371429938
VRL886       12367      369022583
VRL887       7720       230064788
VRL888       12689      377040785
VRL889       12696      377435664
VRL89        7414       220726320
VRL890       12564      375068053
VRL891       12421      370661452
VRL892       12556      374506757
VRL893       12559      375397390
VRL894       1985       59310040
VRL895       12563      375268346
VRL896       12493      373092601
VRL897       12544      376479221
VRL898       7193       214852674
VRL899       12208      364524330
VRL9         130922     139330909
VRL90        3112       82363030
VRL900       11870      354290693
VRL901       12426      366602335
VRL902       12465      372204456
VRL903       4809       143349099
VRL904       12575      375508602
VRL905       12547      374776214
VRL906       12526      374129811
VRL907       12453      371821049
VRL908       3728       111382956
VRL909       12536      374510811
VRL91        7987       221802828
VRL910       12522      373995879
VRL911       12553      375021905
VRL912       12550      374886399
VRL913       12515      373703906
VRL914       45         1343589
VRL915       12373      369521193
VRL916       12333      368446726
VRL917       12422      370851181
VRL918       10550      315017672
VRL919       12459      373079805
VRL92        9309       221496928
VRL920       12419      371360929
VRL921       12428      371345506
VRL922       4986       148899678
VRL923       12242      369489762
VRL924       12317      367592887
VRL925       12174      365156432
VRL926       4053       115032319
VRL927       12716      367457814
VRL928       12532      367814176
VRL929       12762      364368269
VRL93        7822       220695101
VRL930       12516      362023021
VRL931       10181      295000835
VRL932       12261      364246493
VRL933       11983      358129926
VRL934       11992      358281709
VRL935       11970      357626813
VRL936       8265       246937176
VRL937       11985      358078812
VRL938       11989      358195256
VRL939       12156      363313606
VRL94        3557       86349708
VRL940       6489       193956712
VRL941       12177      363892164
VRL942       12137      362742033
VRL943       12131      362591479
VRL944       3657       109292202
VRL945       12028      359490869
VRL946       12169      363409112
VRL947       12161      363033450
VRL948       12058      360081778
VRL949       12080      360896706
VRL95        9355       218778672
VRL950       12014      358872295
VRL951       2730       81547016
VRL952       12189      364192061
VRL953       12163      363192710
VRL954       12165      363203605
VRL955       12155      362921616
VRL956       12158      362938293
VRL957       12161      363091473
VRL958       2684       80138103
VRL959       12166      363165165
VRL96        8379       221600861
VRL960       12166      363241275
VRL961       12170      363353847
VRL962       12156      362931637
VRL963       12160      363069167
VRL964       12172      363405368
VRL965       4051       120940847
VRL966       12163      363155849
VRL967       12161      363080282
VRL968       12159      363040526
VRL969       12167      363291692
VRL97        8460       222826395
VRL970       8121       242458743
VRL971       12179      363588312
VRL972       12288      366296193
VRL973       12230      364766866
VRL974       12230      364839180
VRL975       7809       232891999
VRL976       12517      372202470
VRL977       12314      367044713
VRL978       12278      366328806
VRL979       12245      365344345
VRL98        4327       101914676
VRL980       11804      352066227
VRL981       12261      365697368
VRL982       12496      371789496
VRL983       12719      377385868
VRL984       12715      377344810
VRL985       1217       36116332
VRL986       12713      377392716
VRL987       12718      377715037
VRL988       12722      377819305
VRL989       3915       116278053
VRL99        10055      222318712
VRL990       12719      377541904
VRL991       12718      377586495
VRL992       12684      377060528
VRL993       8611       255698002
VRL994       12709      377317035
VRL995       12707      377302448
VRL996       12704      377157720
VRL997       6978       207185151
VRL998       12712      377452061
VRL999       12713      377484768
VRT1         70127      272336515
VRT10        37396      74041240
VRT100       1          252032905
VRT101       1          217689105
VRT102       1          199443007
VRT103       1          198537509
VRT104       2          368166310
VRT105       2          330550494
VRT106       1          146904662
VRT107       3          319096504
VRT108       7          379783228
VRT109       11         374771935
VRT11        18698      27611025
VRT110       13         379441801
VRT111       3          70710155
VRT112       16         344076996
VRT113       10         385210617
VRT114       15         392781064
VRT115       22         370094349
VRT116       1          839681426
VRT117       1          825560060
VRT118       1          595904407
VRT119       1          486875112
VRT12        5986       380511905
VRT120       1          387033265
VRT121       1          371528181
VRT122       1          313513962
VRT123       1          277530821
VRT124       1          268302114
VRT125       3          319484498
VRT126       5          386368861
VRT127       7          393936069
VRT128       7          384166854
VRT129       1          46063367
VRT13        3363       217068541
VRT130       7          344525641
VRT131       6          384186008
VRT132       8          388949147
VRT133       332        334400544
VRT134       1          222115097
VRT135       3          377547369
VRT136       10         383496928
VRT137       33         389650655
VRT138       6          59236435
VRT139       1          772932187
VRT14        4685       4674270
VRT140       1          662004353
VRT141       1          535506559
VRT142       1          376147139
VRT143       1          364230008
VRT144       1          346409914
VRT145       1          311292523
VRT146       1          247732340
VRT147       1          228143320
VRT148       1          221182781
VRT149       2          321892640
VRT15        1171       26255719
VRT150       490        332426844
VRT151       12         378048109
VRT152       9          378909870
VRT153       6          345737823
VRT154       2          137693511
VRT155       7          385107928
VRT156       8          360581972
VRT157       10         364952837
VRT158       4          133261911
VRT159       8          359905961
VRT16        293        13983146
VRT160       5          370674748
VRT161       9          378247816
VRT162       6          166907986
VRT163       14         379842153
VRT164       15         375595384
VRT165       41         289507176
VRT166       11         366984719
VRT167       14         374291772
VRT168       10         185283047
VRT169       1          550518975
VRT17        37         392789976
VRT170       1          529596002
VRT171       1          413748038
VRT172       1          326378286
VRT173       1          272612222
VRT174       1          260396842
VRT175       1          197956435
VRT176       2          384149701
VRT177       2          288058306
VRT178       4          353983664
VRT179       461        371881983
VRT18        13         392458500
VRT180       2          310725315
VRT181       2          280326572
VRT182       3          371471404
VRT183       3          354148189
VRT184       3          303679844
VRT185       4          341249946
VRT186       598        371557989
VRT187       13         392880011
VRT188       13         164097178
VRT189       1          313568160
VRT19        12         379958897
VRT190       1          289498315
VRT191       1          277254249
VRT192       1          244324502
VRT193       1          233859027
VRT194       1          225974235
VRT195       1          211674833
VRT196       1          199962141
VRT197       2          390673241
VRT198       2          334991523
VRT199       2          324316137
VRT2         72833      271627158
VRT20        11         316368323
VRT200       2          292002398
VRT201       1          133841611
VRT202       3          336899598
VRT203       28         389500106
VRT204       6          332993899
VRT205       6          378599539
VRT206       1          47256133
VRT207       6          330076811
VRT208       7          362796652
VRT209       8          365387335
VRT21        13         385338369
VRT210       20         273534543
VRT211       9          378632578
VRT212       11         392575991
VRT213       205        341394663
VRT214       7          347210350
VRT215       7          370650631
VRT216       8          391548385
VRT217       6          385659507
VRT218       7          341110862
VRT219       1          55350661
VRT22        14         372163844
VRT220       8          387616857
VRT221       3          259325358
VRT222       5          392602723
VRT223       41         394037361
VRT224       3          148003845
VRT225       7          387415360
VRT226       7          365756282
VRT227       6          352657526
VRT228       5          346047628
VRT229       2          134650353
VRT23        14         352781625
VRT230       5          356250620
VRT231       6          374573269
VRT232       6          364137996
VRT233       7          343458516
VRT234       2          121348818
VRT235       7          358240592
VRT236       8          383435354
VRT237       8          365970383
VRT238       6          357597984
VRT239       7          355728138
VRT24        19         384683297
VRT240       8          362648569
VRT241       7          390172982
VRT242       8          391413434
VRT243       8          377681388
VRT244       1          42933508
VRT245       100        376541917
VRT246       20         391000381
VRT247       13         383659375
VRT248       58         386123281
VRT249       11         394338841
VRT25        16         379729070
VRT250       11         274288418
VRT251       1          843366180
VRT252       1          842558404
VRT253       1          707956555
VRT254       1          635713434
VRT255       1          567300182
VRT256       1          439630435
VRT257       1          236595445
VRT258       1          231667822
VRT259       2          382351630
VRT26        16         381718727
VRT260       2          103223822
VRT261       1          690654357
VRT262       1          541439571
VRT263       1          495417988
VRT264       1          481763206
VRT265       1          429350720
VRT266       1          224823088
VRT267       1          212589178
VRT268       2          374746477
VRT269       2          318111367
VRT27        2          51507477
VRT270       32         270969991
VRT271       2          352563619
VRT272       7          386835620
VRT273       4317       352826229
VRT274       19         370712563
VRT275       15986      152828107
VRT276       139086     132684752
VRT277       144321     126138212
VRT278       137848     133203156
VRT279       7177       8573810
VRT28        6          344600068
VRT280       128041     142650795
VRT281       130350     142477718
VRT282       127212     136589973
VRT283       49019      108085992
VRT284       3          351846198
VRT285       5          374381301
VRT286       16         387558511
VRT287       48         262478695
VRT288       14         376657571
VRT289       16         394062851
VRT29        7          384846875
VRT290       16         377073984
VRT291       8          278699154
VRT292       13         345916081
VRT293       3          386677656
VRT294       5          363840571
VRT295       25         336198071
VRT296       10         365551181
VRT297       392        383359217
VRT298       3          345650541
VRT299       4          347682430
VRT3         9032       335126292
VRT30        7          359521465
VRT300       8          375481157
VRT301       12         376742698
VRT302       33         366827136
VRT303       11         349043615
VRT304       35         386781479
VRT305       3          345588977
VRT306       4          349532575
VRT307       6          304738240
VRT308       7          374752607
VRT309       9          383055365
VRT31        6          265537261
VRT310       13         380263163
VRT311       17         345430885
VRT312       9          382470915
VRT313       10         392600820
VRT314       9          279911807
VRT315       9          254611438
VRT316       4          93451292
VRT317       92         46093787
VRT318       1          427870202
VRT319       1          378320336
VRT32        2          352172328
VRT320       1          361305601
VRT321       1          335235059
VRT322       1          330123935
VRT323       1          263823987
VRT324       2          310916606
VRT325       2          280963255
VRT326       2          253397968
VRT327       29         196709870
VRT328       14         353408674
VRT329       9          362327333
VRT33        4          299372801
VRT330       12         386562662
VRT331       37         393359699
VRT332       1          197209046
VRT333       4          354626559
VRT334       14         388834320
VRT335       19         380393320
VRT336       6          393746332
VRT337       3          88205163
VRT338       142        344732119
VRT339       5          347463485
VRT34        33         361630329
VRT340       7          380950384
VRT341       7          382163289
VRT342       1          41123832
VRT343       1534       370418439
VRT344       13         372631033
VRT345       41         382643657
VRT346       14         376221586
VRT347       27         384724785
VRT348       24         309028163
VRT349       1          359753992
VRT35        2          87752637
VRT350       1          294454259
VRT351       2          339959923
VRT352       4          389503140
VRT353       17         386338679
VRT354       15         391956294
VRT355       9          391549346
VRT356       8          381532502
VRT357       10         359729387
VRT358       16         366027269
VRT359       14         376088571
VRT36        1          317477549
VRT360       7          235869622
VRT361       2          242903655
VRT362       1          103130777
VRT363       2          195276619
VRT364       3          251633161
VRT365       5          300573695
VRT366       66         301934620
VRT367       25         392090725
VRT368       2          90346900
VRT369       10         381757438
VRT37        1          272440768
VRT370       13         384001666
VRT371       18         378998104
VRT372       14         354514736
VRT373       15         389607510
VRT374       7          359846472
VRT375       10         392276936
VRT376       11         351492602
VRT377       12         385397876
VRT378       11         360161366
VRT379       6          387856588
VRT38        2          394160013
VRT380       6          342298758
VRT381       7          364180089
VRT382       6          278597912
VRT383       4          383566318
VRT384       4          341682881
VRT385       5          369366758
VRT386       1          168556870
VRT387       4          366711607
VRT388       12         382161691
VRT389       284        370923374
VRT39        2          283573173
VRT390       16         348486879
VRT391       8          306781019
VRT392       16         388050719
VRT393       11         367388364
VRT394       14         365878669
VRT395       12         375095837
VRT396       1          25932624
VRT397       24         353612648
VRT398       6          369805903
VRT399       7          384607923
VRT4         3          141387178
VRT40        7          391094812
VRT400       8          368212165
VRT401       5          378213586
VRT402       5          365493039
VRT403       33         331537940
VRT404       2          361339847
VRT405       5          387184689
VRT406       27         349981705
VRT407       2          365371943
VRT408       3          264326299
VRT409       27         376036092
VRT41        15         377074715
VRT410       12         388111625
VRT411       15         355427980
VRT412       9          359004013
VRT413       14         370674190
VRT414       6          357293315
VRT415       9          392750267
VRT416       19         345301356
VRT417       2          270081366
VRT418       3          337747199
VRT419       4          372760969
VRT42        16         378051631
VRT420       6          374441870
VRT421       2          91343234
VRT422       12         365458181
VRT423       14         381904327
VRT424       10         379659381
VRT425       12         335882457
VRT426       9          338107238
VRT427       11         341554810
VRT428       6          306672347
VRT429       3          364841512
VRT43        16         393985227
VRT430       1          78184682
VRT431       13         391321309
VRT432       29         394238386
VRT433       11         392187451
VRT434       12         390891610
VRT435       4          124618305
VRT436       13         374791117
VRT437       7          346762788
VRT438       3          331274494
VRT439       5          372585365
VRT44        3          86805314
VRT440       14         232250556
VRT441       2          330011643
VRT442       3          358143180
VRT443       11         388706206
VRT444       24         346842850
VRT445       6          345978928
VRT446       7          376870570
VRT447       9          387109889
VRT448       11         379427132
VRT449       15         388456477
VRT45        14         389494801
VRT450       5          157396317
VRT451       14         377957244
VRT452       8          345961660
VRT453       6          347102316
VRT454       7          364305083
VRT455       11         385521663
VRT456       3          81529282
VRT457       19         381211211
VRT458       10         368005998
VRT459       14         324630407
VRT46        9          384839466
VRT460       7          384040912
VRT461       7          235089840
VRT462       9          338687749
VRT463       3          346419818
VRT464       4          380278921
VRT465       6          383580844
VRT466       7          343415827
VRT467       4          389369168
VRT468       11         380910127
VRT469       7          98500808
VRT47        6          336995308
VRT470       19         254956808
VRT471       2          291755981
VRT472       3          360820401
VRT473       4          344804531
VRT474       6          391793029
VRT475       8          391276700
VRT476       10         368423877
VRT477       6          157808144
VRT478       19         379169371
VRT479       16         364202069
VRT48        7          350849012
VRT480       12         386705760
VRT481       13         306516285
VRT482       4          349398949
VRT483       2          133605418
VRT484       6          347628123
VRT485       9          341764128
VRT486       6          365068972
VRT487       6          342787609
VRT488       6          308617737
VRT489       10         384491294
VRT49        5          366382703
VRT490       14         389301294
VRT491       11         368401372
VRT492       10         374526855
VRT493       7          233168748
VRT494       12         387903636
VRT495       12         273005563
VRT496       3          388044281
VRT497       6          366621651
VRT498       296        393199124
VRT499       2          80871223
VRT5         8          354279535
VRT50        29         124536891
VRT500       11         373748625
VRT501       14         366822435
VRT502       11         365008097
VRT503       10         274733604
VRT504       20         383991608
VRT505       18         374257048
VRT506       11         380849608
VRT507       13         372589174
VRT508       16         380034294
VRT509       3          272249881
VRT51        147        10842596
VRT510       1          252427829
VRT511       1          232456983
VRT512       1          205008019
VRT513       2          392288911
VRT514       2          351830105
VRT515       2          288333877
VRT516       3          333388282
VRT517       1          80635905
VRT518       5          365305650
VRT519       6          369739140
VRT52        586        15797052
VRT520       10         283558167
VRT521       1          218912229
VRT522       3          384030580
VRT523       7          389337170
VRT524       27         323834034
VRT525       5          384750338
VRT526       3          211675779
VRT527       5          331936094
VRT528       6          376936920
VRT529       8          379921315
VRT53        2343       67436863
VRT530       7          351187556
VRT531       8          356255842
VRT532       2          81521057
VRT533       6          356448109
VRT534       2          300042709
VRT535       4          343155882
VRT536       27         372183258
VRT537       2          82892496
VRT538       11         391249070
VRT539       14         393981192
VRT54        19198      357652178
VRT540       12         392610122
VRT541       11         247118506
VRT542       2          362356944
VRT543       1          119285422
VRT544       8          389337057
VRT545       29         266592469
VRT546       2          386396328
VRT547       3          309996050
VRT548       8          384942504
VRT549       24         351207841
VRT55        54117      304769938
VRT550       9          367245368
VRT551       10         316384480
VRT552       1          323290686
VRT553       1          233753858
VRT554       1          214419092
VRT555       1          209264451
VRT556       1          208108668
VRT557       2          373417761
VRT558       2          309104008
VRT559       2          271054822
VRT56        158586     137240898
VRT560       2          260221955
VRT561       3          342061807
VRT562       5          386286873
VRT563       4          369183200
VRT564       6          363973728
VRT565       1          34755123
VRT566       10         261792696
VRT567       2          366392779
VRT568       5          391744418
VRT569       35         388463791
VRT57        18257      13430736
VRT570       4          271170584
VRT571       8          364917051
VRT572       10         370973542
VRT573       12         388922986
VRT574       12         380991864
VRT575       26748      124910215
VRT58        117663     200715195
VRT59        84324      68322007
VRT6         11         387350249
VRT60        156210     129529828
VRT61        40549      26960978
VRT62        185395     123424073
VRT63        149940     106568691
VRT64        168276     113417753
VRT65        8563       7336686
VRT66        133023     105741590
VRT67        156317     117973785
VRT68        142306     87473811
VRT69        188485     120062689
VRT7         11         393947221
VRT70        103272     61402986
VRT71        157458     119340880
VRT72        160403     124687386
VRT73        8144       373921756
VRT74        326        389273252
VRT75        1595       387372006
VRT76        93755      270827182
VRT77        145106     21008965
VRT78        75789      25336814
VRT79        13375      365641119
VRT8         30744      333424138
VRT80        20         379347618
VRT81        269        392772876
VRT82        3056       391160250
VRT83        3483       231235844
VRT84        6925       378855996
VRT85        16         388667304
VRT86        16         378559418
VRT87        12         379509384
VRT88        7          285874095
VRT89        12         385137967
VRT9         74952      70629379
VRT90        18         367776429
VRT91        16         386329687
VRT92        229        277860126
VRT93        17         367327734
VRT94        15         385834222
VRT95        7          149460915
VRT96        1          356776219
VRT97        1          350268637
VRT98        1          316334699
VRT99        1          337490635

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 260.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

8798641 261765900426   Severe acute respiratory syndrome coronavirus 2
1943737 241123815056   Triticum aestivum
111961  205666444201   Hordeum vulgare
1347585 126087260773   Hordeum vulgare subsp. vulgare
520     106587373982   Hordeum bulbosum
164      93011095388   Viscum album
29875    92980158068   Hordeum vulgare subsp. spontaneum
10047949 43636846379   Mus musculus
27805521 34339908455   Homo sapiens
174296   23455595392   Escherichia coli
29719    21127974414   Avena sativa
2640644  19850191551   Arabidopsis thaliana
2243693  16210139196   Bos taurus
33120    15955010198   Klebsiella pneumoniae
1732291  13758449255   Danio rerio
195      11554711366   Sambucus nigra
28766    11286173222   Vicia faba
14811    10342955286   Triticum monococcum
23130     9981582961   Triticum turgidum subsp. durum
704       9808543625   Heterocephalus glaber

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   247   Dec 2021  1053275115030   234557297
   248   Feb 2022  1173984081721   236338284
   249   Apr 2022  1266154890918   237520318
   250   Jun 2022  1395628631187   239017893
   251   Aug 2022  1492800704497   239915786
   252   Oct 2022  1562963366851   240539282
   253   Dec 2022  1635594138493   241015745
   254   Feb 2023  1731302248418   241830635
   255   Apr 2023  1826746318813   242554936
   256   Jun 2023  1966479976146   243560863
   257   Aug 2023  2112058517945   246119175
   258   Oct 2023  2433391164875   247777761
   259   Dec 2023  2570711588044   249060436
   n/a   Feb 2024  n/a             n/a         No GenBank Release delivery for Feb 2024
   260   Apr 2024  3213818003787   250803006
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101
  247    Dec 2021 14922033922302  1734664952
  248    Feb 2022 15428122140820  1750505007
  249    Apr 2022 16071520702170  1781374217
  250    Jun 2022 16710373006600  1796349114
  251    Aug 2022 17511809676629  2024099677
  252    Oct 2022 18231960808828  2167900306
  253    Dec 2022 19086596616569  2241439349
  254    Feb 2023 20116642176263  2337838461
  255    Apr 2023 20926504760221  2440470464
  256    Jun 2023 21791125594114  2611654455
  257    Aug 2023 22294446104543  2631493489
  258    Oct 2023 23600199887231  2775205599
  259    Dec 2023 24651580464335  2863228552
  n/a    Feb 2024 n/a             n/a         No GenBank Release delivery for Feb 2024
  260    Apr 2024 27225116587937  3333621823

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391
  247    Dec 2021   455870853358   514158576
  248    Feb 2022   465013156502   524464601
  249    Apr 2022   474421076448   534770586
  250    Jun 2022   485056129761   546991572
  251    Aug 2022   497501380386   560196830
  252    Oct 2022   511476787957   574020080
  253    Dec 2022   611850391049   649918843
  254    Feb 2023   630615054587   672261981
  255    Apr 2023   636291358227   678332682
  256    Jun 2023   643127590034   683922756
  257    Aug 2023   646176166908   686271945
  258    Oct 2023   659924904311   701336089
  259    Dec 2023   668807109326   715803123
  n/a    Feb 2024   n/a            n/a         No GenBank Release delivery for Feb 2024
  260    Apr 2024   689648317082   741066498

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935
  247    Dec 2021    41143480750   109379021
  248    Feb 2022    41321107981   109809966
  249    Apr 2022    41324192343   109820387
  250    Jun 2022    41999358847   111142107
  251    Aug 2022    43852280645   115103527
  252    Oct 2022    43860512749   115123306
  253    Dec 2022    44009657455   115552377
  254    Feb 2023    46465508548   121067644
  255    Apr 2023    46567924833   121186672
  256    Jun 2023    47302831210   122798571
  257    Aug 2023    48289699026   124421006
  258    Oct 2023    50868407906   130654568
  259    Dec 2023    51568356978   132355132
  n/a    Feb 2024    n/a           n/a         No GenBank Release delivery for Feb 2024
  260    Apr 2024    53492243256   135115766

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          April 15 2024

                NCBI-GenBank Flat File Release 260.0

                     Bacterial Sequences (Part 1)

  102016 loci,   184379131 bases, from   102016 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, possibly 'LINEAGE'. But because changes like this can be
   very disruptive for customers, implementation has not yet been scheduled.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
   Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
   Volume 52, Issue D1, January 2024, pp. D134-D137.

   PMID:  37889039
   PMCID: PMC10767886
   DOI:   10.1093/nar/gkad903

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Genome Workbench can be used to submit revisions to
previous submissions.  In addition, suggestions and corrections can
be sent by electronic mail to:  update@ncbi.nlm.nih.gov.  Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
	Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Erica Lam,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
	Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
	Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
	Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
	Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
	Majda Valjavec-Gratian

Project Direction/Leadership
	Steve Sherry      : Acting Director, NLM
	Kim Pruitt        : Acting Director, NCBI
	Valerie Schneider : Acting Branch Chief, NCBI/IEB
	Eugene Yaschenko  : Chief Technology Officer, NCBI/IRB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center